AGI ID: At4g30080

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: transcription factor like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At4g30080
MINVMNPMKG GTEKGLDPQL WHACAGGMVR MPPMNSKVFY FPQGHAENAY DCVDFGNLPI
PPMVLCRVLA IKYMADAESD EVFAKLRLIP LKDDEYVDHE YGDGEDSNGF ESNSEKTPSF
AKTLTQSDAN NGGGFSVPRY CAETIFPRLD YNAEPPVQTI LAKDVHGDVW KFRHIYRGTP
RRHLLTTGWS NFVNQKKLVA GDSIVFMRAE NGDLCVGIRR AKRGGIGNGP EYSAGWNPIG
GSCGYSSLLR EDESNSLRRS NCSLADRKGK VTAESVIEAA TLAISGRPFE VVYYPRASTS
EFCVKALDAR AAMRIPWCSG MRFKMAFETE DSSRISWFMG TVSAVNVSDP IRWPNSPWRL
LQVAWDEPDL LQNVKRVNPW LVELVSNVHP IPLTSFSPPR KKMRLPQHPD YNNLINSIPV
PSFPSNPLIR SSPLSSVLDN VPVGLQGARH NAHQYYGLSS SDLHHYYLNR PPPPPPPSSL
QLSPSLGLRN IDTKNEKGFC FLTMGTTPCN DTKSKKSHIV LFGKLILPEE QLSEKGSTDT
ANIEKTQISS GGSNQNGVAG REFSSSDEGS PCSKKVHDAS GLETGHCKVF MESDDVGRTL
DLSVLGSYEE LSRKLSDMFG IKKSEMLSSV LYRDASGAIK YAGNEPFSEF LKTARRLTIL
TEQGSESVVV
Length = 670 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At4g30080

>At4g30080 transcription factor  like protein
          Length = 670

 Score =  459 bits (1181), Expect = e-129
 Identities = 157/462 (33%), Positives = 224/462 (47%), Gaps = 62/462 (13%)

Query: 43  QSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNL 102
           + GT K  ++ +LWHACAG +V +P + S V+YF QGH+E               N P +
Sbjct: 9   KGGTEKG-LDPQLWHACAGGMVRMPPMNSKVFYFPQGHAENA------YDCVDFGNLP-I 60

Query: 103 PSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDV----FPVPDFGMLRGSKHPTEFF 158
           P  ++C+V  +   AD +SDE++A++ L P+  +  V        D      +   T  F
Sbjct: 61  PPMVLCRVLAIKYMADAESDEVFAKLRLIPLKDDEYVDHEYGDGEDSNGFESNSEKTPSF 120

Query: 159 CKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQP 218
            KTLT SD +  GGFSVPR  AE +FP LDY+A+PP Q ++ +D+H + W FRHIYRG P
Sbjct: 121 AKTLTQSDANNGGGFSVPRYCAETIFPRLDYNAEPPVQTILAKDVHGDVWKFRHIYRGTP 180

Query: 219 KRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANR----------------Q 262
           +RHLLTTGWS FV  K+L AGDS++F+R E   L VG+RRA R                 
Sbjct: 181 RRHLLTTGWSNFVNQKKLVAGDSIVFMRAENGDLCVGIRRAKRGGIGNGPEYSAGWNPIG 240

Query: 263 QTALPSSVLSADSMHI-------------GVLXXXXXXXXN----RTPFLIFYNPRACPA 305
            +   SS+L  D  +               V                PF + Y PRA  +
Sbjct: 241 GSCGYSSLLREDESNSLRRSNCSLADRKGKVTAESVIEAATLAISGRPFEVVYYPRASTS 300

Query: 306 EFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKR-RYMGTIVGISDLDPLRWPGSKWR 364
           EF +     R A+     S GMRF M FETEDS +   +MGT+  ++  DP+RWP S WR
Sbjct: 301 EFCVKALDARAAMRIPWCS-GMRFKMAFETEDSSRISWFMGTVSAVNVSDPIRWPNSPWR 359

Query: 365 NLQVEWDEPGCNDKPTRVSPWDIE-----TPESLFIFPSLTSGLKRQLHPSYFAGETEWG 419
            LQV WDEP       RV+PW +E      P  L  F      ++   HP Y        
Sbjct: 360 LLQVAWDEPDLLQNVKRVNPWLVELVSNVHPIPLTSFSPPRKKMRLPQHPDY-------- 411

Query: 420 SLIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQ 461
           + +   +      +N ++  +   S+     + + ++   + 
Sbjct: 412 NNLINSIPVPSFPSNPLIRSSPLSSVLDN--VPVGLQGARHN 451



 Score = 85.3 bits (210), Expect = 2e-16
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 797 KVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLV 855
           KV      VGR++D++    YEEL   +  MFG++   +   SS   ++Y D    +   
Sbjct: 588 KVFMESDDVGRTLDLSVLGSYEELSRKLSDMFGIKK--SEMLSS---VLYRDASGAIKYA 642

Query: 856 GDDPWEEFVGCVRCIRILS 874
           G++P+ EF+   R + IL+
Sbjct: 643 GNEPFSEFLKTARRLTILT 661


InterPro Results:

IPR000504 Domain
PS00030 ?[497-504] NA RRM_RNP_1
RNA-binding region RNP-1 (RNA recognition motif)
IPR003340 Family
PF02362 T[119-224] 3.5e-12 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[279-362] 7.8e-52 Auxin_resp
Auxin response factor
NULL
seg ?[471-488] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5459 e-129
TF_17_3 ARFETTIN/ARF3451 e-127
TF_17_2 ARFNPH4/ARF7450 e-126
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3129 5e-30
TF_22_1 ABI3/VP1FUSCA3114 6e-26
TF_55 Aux/IAA 80 1e-15

TOP