AGI ID: At4g28610

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At4g28610
MEARPVHRSG SRDLTRTSSI PSTQKPSPVE DSFMRSDNNS QLMSRPLGQT YHLLSSSNGG
AVGHICSSSS SGFATNLHYS TMVSHEKQQH YTGSSSNNAV QTPSNNDSAW CHDSLPGGFL
DFHETNPAIQ NNCQIEDGGI AAAFDDIQKR SDWHEWADHL ITDDDPLMST NWNDLLLETN
SNSDSKDQKT LQIPQPQIVQ QQPSPSVELR PVSTTSSNSN NGTGKARMRW TPELHEAFVE
AVNSLGGSER ATPKGVLKIM KVEGLTIYHV KSHLQKYRTA RYRPEPSETG SPERKLTPLE
HITSLDLKGG IGITEALRLQ MEVQKQLHEQ LEIQRNLQLR IEEQGKYLQM MFEKQNSGLT
KGTASTSDSA AKSEQEDKKT ADSKEVPEEE TRKCEELESP QPKRPKIDN
Length = 409 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At4g28610

>At4g28610 unknown protein
          Length = 409

 Score =  123 bits (309), Expect = 4e-28
 Identities = 43/69 (62%), Positives = 52/69 (75%)

Query: 178 PQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQ 237
              +  G  K+R+RWTPELH  FV AVNSLGG ++ATPKG+LK+M V+GLTIYH+KSHLQ
Sbjct: 216 SSNSNNGTGKARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQ 275

Query: 238 KYRLNIRLP 246
           KYR     P
Sbjct: 276 KYRTARYRP 284



 Score = 94.3 bits (233), Expect = 2e-19
 Identities = 23/44 (52%), Positives = 32/44 (72%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEG 428
           + EAL  QME+QK+LHEQLE QR LQL +E  G+Y+  + E++ 
Sbjct: 313 ITEALRLQMEVQKQLHEQLEIQRNLQLRIEEQGKYLQMMFEKQN 356


InterPro Results:

IPR001005 Domain
PF00249 T[227-278] 3e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[225-281] 3.6e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[221-285] 4.8e-19 Homeodomain-like
Homeodomain-like
NULL
coil ?[314-335] coiled-coil
seg ?[192-207]?[213-224] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like123 4e-28
TF_10_2 GARPARR-B class102 3e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 78 1e-14
TF_1_2 MYB superfamilyLHY 69 7e-12

TOP