AGI ID: At4g23980

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor 9 (ARF9)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At4g23980
MANRGGEYLY DELWKLCAGP LVDVPQAQER VYYFPQGHME QLEASTQQVD LNTMKPLFVL
PPKILCNVMN VSLQAEKDTD EVYAQITLIP VGTEVDEPMS PDPSPPELQR PKVHSFSKVL
TASDTSTHGG FSVLRKHATE CLPPLDMTQQ TPTQELVAED VHGYQWKFKH IFRGQPRRHL
LTTGWSTFVT SKRLVAGDTF VFLRGENGEL RVGVRRANLQ QSSMPSSVIS SHSMHLGVLA
TARHATQTKT MFIVYYKPRT SQFIISLNKY LEAMSNKFSV GMRFKMRFEG EDSPERRYSG
TVIGVKDCSP HWKDSKWRCL EVHWDEPASI SRPNKVSPWE IEPFVNSENV PKSVMLKNKR
PRQVSEVSAL DVGITASNLW SSVLTQPHEF AQSCITSQWS SPQQCHRDAN EDAKKSDWLN
NSYSVSNVAK DSTLNDQMVS PVEQKKPETT ANYRLFGIDL MSSSLAVPEE KTAPMRPINI
SKPTMDSHSD PKSEISKVSE EKKQEPAEGS PKEVQSKQSS STRSRTKVQM QGVPVGRAVD
LNALKGYNEL IDDIEKLFDI KGELRSRNQW EIVFTDDEGD MMLVGDDPWP EFCNMVKRIF
IWSKEEVKKM TPGNQLRMLL REVETTLTTT SKTDNHSN
Length = 638 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At4g23980

>At4g23980 auxin response factor 9 (ARF9)
          Length = 638

 Score =  573 bits (1476), Expect = e-163
 Identities = 198/540 (36%), Positives = 268/540 (48%), Gaps = 53/540 (9%)

Query: 40  LKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNY 99
           + ++ G     +  ELW  CAGPLV +PQ    VYYF QGH EQ+  ST++     +   
Sbjct: 1   MANRGGE---YLYDELWKLCAGPLVDVPQAQERVYYFPQGHMEQLEASTQQVDLNTMKPL 57

Query: 100 PNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFC 159
             LP +++C V NV+L A+KD+DE+YAQ++L PV +E D    PD       +     F 
Sbjct: 58  FVLPPKILCNVMNVSLQAEKDTDEVYAQITLIPVGTEVDEPMSPDPSPPELQRPKVHSFS 117

Query: 160 KTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPK 219
           K LTASDTSTHGGFSV R+ A +  PPLD + Q PTQELV  D+H   W F+HI+RGQP+
Sbjct: 118 KVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKHIFRGQPR 177

Query: 220 RHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIG 279
           RHLLTTGWS FV SKRL AGD+ +F+R E  +L VGVRRAN QQ+++PSSV+S+ SMH+G
Sbjct: 178 RHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANLQQSSMPSSVISSHSMHLG 237

Query: 280 VLXXXXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSG 339
           VL         +T F+++Y PR   ++F+I L KY +A+  ++ SVGMRF M FE EDS 
Sbjct: 238 VLATARHATQTKTMFIVYYKPRT--SQFIISLNKYLEAM-SNKFSVGMRFKMRFEGEDSP 294

Query: 340 KRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFP-S 398
           +RRY GT++G+ D  P  W  SKWR L+V WDEP    +P +VSPW+IE   +    P S
Sbjct: 295 ERRYSGTVIGVKDCSP-HWKDSKWRCLEVHWDEPASISRPNKVSPWEIEPFVNSENVPKS 353

Query: 399 LTSGLKRQ------------------LHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYA 440
           +    KR                                S I                 A
Sbjct: 354 VMLKNKRPRQVSEVSALDVGITASNLWSSVLTQPHEFAQSCITSQWSSPQQCHRDANEDA 413

Query: 441 SFPSMA--SEQLMKMMM-RPHNNQNVPSFMSEMQQNIVMGNGGLLGDMKMQQPL------ 491
                   S  +  +      N+Q V     +  +     N  L G   M   L      
Sbjct: 414 KKSDWLNNSYSVSNVAKDSTLNDQMVSPVEQKKPE--TTANYRLFGIDLMSSSLAVPEEK 471

Query: 492 ------------MMNQKSEMVQPQNKLTVNPSASNTSGQE----QNLSQSMSAPAKPENS 535
                        M+  S+     +K++         G         S S  +  K +  
Sbjct: 472 TAPMRPINISKPTMDSHSDPKSEISKVSEEKKQEPAEGSPKEVQSKQSSSTRSRTKVQMQ 531



 Score =  145 bits (366), Expect = 1e-34
 Identities = 68/321 (21%), Positives = 112/321 (34%), Gaps = 68/321 (21%)

Query: 631 PFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMS---- 686
             ++  +D S                WD   +  + ++ SP   +    S+N+  S    
Sbjct: 300 GTVIGVKDCSPHWKDSKW--RCLEVHWDEPASISRPNKVSPWEIEPFVNSENVPKSVMLK 357

Query: 687 ---------------NSTTSNILDPPLSNT-VLDDFCAIKD--TDFQNHPSGC------- 721
                            T SN+    L+        C      +  Q H           
Sbjct: 358 NKRPRQVSEVSALDVGITASNLWSSVLTQPHEFAQSCITSQWSSPQQCHRDANEDAKKSD 417

Query: 722 -LVGNNNTS-------------FAQDVQSQITSASF--------ADSQAFSR----QDFP 755
            L  + + S                + +   T+A++        + S A          P
Sbjct: 418 WLNNSYSVSNVAKDSTLNDQMVSPVEQKKPETTANYRLFGIDLMSSSLAVPEEKTAPMRP 477

Query: 756 DNXXXXXXXXXNVDFDDCSLRQ------NSKGSSW--QKIATPRVRTYTKVQKTG-SVGR 806
            N         +    + S          ++GS    Q   +   R+ TKVQ  G  VGR
Sbjct: 478 INISKPTMDSHSDPKSEISKVSEEKKQEPAEGSPKEVQSKQSSSTRSRTKVQMQGVPVGR 537

Query: 807 SIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGC 866
           ++D+ + K Y EL   IE +F ++G L     + W++V+ D E D++LVGDDPW EF   
Sbjct: 538 AVDLNALKGYNELIDDIEKLFDIKGEL--RSRNQWEIVFTDDEGDMMLVGDDPWPEFCNM 595

Query: 867 VRCIRILSPTEVQQMSEEGMK 887
           V+ I I S  EV++M+     
Sbjct: 596 VKRIFIWSKEEVKKMTPGNQL 616


InterPro Results:

IPR003311 Family
PF02309 T[477-614] 4.2e-05 AUX_IAA
AUX/IAA protein
IPR003340 Family
PF02362 T[115-220] 2.2e-13 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[242-321] 5.2e-58 Auxin_resp
Auxin response factor
NULL
seg ?[96-107]?[222-233]?[492-505]?[514-528]?[625-633] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5573 e-163
TF_17_2 ARFNPH4/ARF7549 e-156
TF_17_3 ARFETTIN/ARF3530 e-151
TF_55 Aux/IAA139 2e-33
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3133 3e-31
TF_22_1 ABI3/VP1FUSCA3121 4e-28

TOP