AGI ID: At4g23750

TF ID:TF_67
Super family:Pti6
Sub family:
Gene name: putative Ap2 domain protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g23750
MEAEKKMVLP RIKFTEHKTN TTTIVSELTN THQTRILRIS VTDPDATDSS SDDEEEEHQR
FVSKRRRVKK FVNEVYLDSG AVVTGSCGQM ESKKRQKRAV KSESTVSPVV SATTTTTGEK
KFRGVRQRPW GKWAAEIRDP LKRVRLWLGT YNTAEEAAMV YDNAAIQLRG PDALTNFSVT
PTTATEKKAP PPSPVKKKKK KNNKSKKSVT ASSSISRSSS NDCLCSPVSV LRSPFAVDEF
SGISSSPVAA VVVKEEPSMT TVSETFSDFS APLFSDDDVF DFRSSVVPDY LGGDLFGEDL
FTADMCTDMN FGFDFGSGLS SWHMEDHFQD IGDLFGSDPL LAV
Length = 343 AA.

PSI BLAST Result:

Query: Query sequence of TF_67
Sbjct: At4g23750

>At4g23750 putative Ap2 domain protein
          Length = 343

 Score =  157 bits (398), Expect = 5e-39
 Identities = 69/173 (39%), Positives = 94/173 (53%), Gaps = 29/173 (16%)

Query: 6   VPVIKFTQHIVTTNKHVFSEHNEKSNSELQRVVRIILXXXXXXXXXXXEGR-------NT 58
           +P IKFT+H   T   V     E +N+   R++RI +           +         + 
Sbjct: 9   LPRIKFTEHKTNTTTIVS----ELTNTHQTRILRISVTDPDATDSSSDDEEEEHQRFVSK 64

Query: 59  VRRVKRHVTEINLMP--------STKSIGDRKRRSVSPDSDVTR----------RKKFRG 100
            RRVK+ V E+ L                 R++R+V  +S V+            KKFRG
Sbjct: 65  RRRVKKFVNEVYLDSGAVVTGSCGQMESKKRQKRAVKSESTVSPVVSATTTTTGEKKFRG 124

Query: 101 VRQRPWGRWAAEIRDPTRGKRVWLGTYDTPEEAAVVYDKAAVKLKGPDAVTNF 153
           VRQRPWG+WAAEIRDP +  R+WLGTY+T EEAA+VYD AA++L+GPDA+TNF
Sbjct: 125 VRQRPWGKWAAEIRDPLKRVRLWLGTYNTAEEAAMVYDNAAIQLRGPDALTNF 177


InterPro Results:

IPR001471 Domain
PD001423 T[128-168] 1e-17 sp_Q9SUQ2_ARATH_Q9SUQ2;
PR00367 T[122-133] 6.8e-11T[144-160] 6.8e-11 ETHRSPELEMNT
PF00847 T[120-183] 4.7e-39 AP2
SM00380 T[121-184] 2.1e-37 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[48-57]?[60-72]?[104-117]?[180-220]?[274-289] seg
SSF54171 T[120-180] 4.1e-24 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_67 Pti6157 5e-39
TF_68 ERF122 1e-28
TF_2_4 AP2/EREBPCBF1119 9e-28
TF_2_2 AP2/EREBPAINTEGUMENTA118 6e-27
TF_2_3 AP2/EREBPAPETALA2117 1e-26
TF_66 Pti5100 3e-22
TF_2_5 AP2/EREBPDREB2A100 2e-21
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 93 3e-19
TF_65 Pti4 82 2e-16

TOP