AGI ID: At4g21550

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: VP1 like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
>At4g21550
GFYICFPLHP CHRLRYLLDF ASTTNVLSSN STIAVLVGVS VLAISSTSVI VAPLRMNKES
FVTYFTKGLL DGGVHFVQRI HCGCIASASA YTLMDAGGIE CLACARKKFA LSPISEKFKD
LSINWSSSTR SNQISYQPPS CLDPSVLQFD FRNRGGNNEF SQPASKERVT ACTMEKKRGM
NDMIGKLMSE NSKHYRVSPF PNVNVYHPLI SLKEGPCGTQ LAFPVPITTP IEKTGHSRLD
GSNLWHTRNS SPLSRLHNDL NGGADSPFES KSRNVMAHLE TPGKYQVVPR FWPKVSYKNQ
VLQNQSKEYP SSLIDTTLEY NFKILSATDT GKRLVLPKKY AEAFLPQLSH TKGVPLTVQD
PMGKEWRFQF RFWPSSKGRI YVLEGVTPFI QTLQLQAGDT VIFSRLDPER KLILGFRKAS
ITQSSDQADP ADMHSPFEVK KSAYITKETP GVECSSGKKK SSMMITRSKR QKVEKGDDNL
LKLTWEEAQG FLLPPPNLTP SRVVIEDYEF EEYEDLAVVS QVSSGIQDYF MILKITCCSY
THWVLEVEAP IIGKPTDVAG STCTEVEGLL ISPTTTKHPR HRDGCTCIIC IQSPSGIGPK
HDRCCSCAVC DTNKRRRRSL LLRREKKQME KEDNARKLLE QLNSDNGLHQ SANNSENHER
HASPLKVQLD LNFKPEKDEE SLPGSNKTTK SETLPHDDTV KSSFTSPSSS SAHSQNNKED
EGKLKTTTEI ADTTTTSSM
Length = 739 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At4g21550

>At4g21550 VP1 like protein
          Length = 739

 Score =  120 bits (302), Expect = 3e-27
 Identities = 34/114 (29%), Positives = 60/114 (51%), Gaps = 7/114 (6%)

Query: 153 HPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRH 212
              E+  K L+A+DT       +P++ AE   P L ++   P   L V+D     W F+ 
Sbjct: 316 TTLEYNFKILSATDTGK--RLVLPKKYAEAFLPQLSHTKGVP---LTVQDPMGKEWRFQF 370

Query: 213 IYRGQPK-RHLLTTGWSLFVGSKRLRAGDSVLFIR-DEKSQLMVGVRRANRQQT 264
            +    K R  +  G + F+ + +L+AGD+V+F R D + +L++G R+A+  Q+
Sbjct: 371 RFWPSSKGRIYVLEGVTPFIQTLQLQAGDTVIFSRLDPERKLILGFRKASITQS 424


InterPro Results:

IPR003340 Family
PF02362 T[320-422] 2.3e-11 B3
Transcriptional factor B3
NULL
coil ?[622-643] coiled-coil
seg ?[615-624]?[702-714]?[726-736] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5120 3e-27
TF_17_3 ARFETTIN/ARF3119 6e-27
TF_22_1 ABI3/VP1FUSCA3108 3e-24
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3105 8e-23
TF_17_2 ARFNPH4/ARF7103 8e-22

TOP