AGI ID: At4g18450

TF ID:TF_2_3
Super family:AP2/EREBP
Sub family:APETALA2
Gene name: EREBP - like protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g18450
MAFGNIQELD GEILKNVWAN YIGTPQTDTR SIQVPEVSRT WEALPTLDDI PEGSREMLQS
LDMSTEDQEW TEILDAIASF PNKTNHDPLT NPTIDSCSLS SRVSCKTRKY RGVRKRPWGK
FAAEIRDSTR NGVRVWLGTF QTAEEAAMAY DKAAVRIRGT QKAHTNFQLE TVIKAMEMDC
NPNYYRMNNS NTSDPLRSSR KIGLRTGKEA VKAYDEVVDG MVENHCALSY CSTKEHSETR
GLRGSEETWF DLRKRRRSNE DSMCQEVEMQ KTVTGEETVC DVFGLFEFED LGSDYLETLL
SSF
Length = 303 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_3
Sbjct: At4g18450

>At4g18450 EREBP - like protein
          Length = 303

 Score =  113 bits (283), Expect = 2e-25
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 214 STGFPRGSSKYRGVTLHKCGRWEARMGQFLGK-KYVYLGLFDTEVEAARAYDKAAIKCNG 272
           S+     + KYRGV     G++ A +         V+LG F T  EAA AYDKAA++  G
Sbjct: 100 SSRVSCKTRKYRGVRKRPWGKFAAEIRDSTRNGVRVWLGTFQTAEEAAMAYDKAAVRIRG 159

Query: 273 -KDAVTNFDPSIYDEELNAESSGNPTTPQDHNLDLSLGNSANSKHKSQDMRLRM 325
            + A TNF      + +  + + N     + N       +++    S+ + LR 
Sbjct: 160 TQKAHTNFQLETVIKAMEMDCNPNYYRMNNSN-------TSDPLRSSRKIGLRT 206


InterPro Results:

IPR001471 Domain
PD001423 T[116-157] 4e-10 sp_O49515_ARATH_O49515;
PR00367 T[110-121] 6.3e-12T[133-149] 6.3e-12 ETHRSPELEMNT
PF00847 T[108-173] 3e-37 AP2
SM00380 T[109-174] 1.3e-35 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[143-154] seg
SSF54171 T[108-170] 8.3e-22 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_3 AP2/EREBPAPETALA2113 2e-25
TF_2_2 AP2/EREBPAINTEGUMENTA109 4e-24
TF_68 ERF107 4e-24
TF_67 Pti6108 4e-24
TF_2_4 AP2/EREBPCBF1104 3e-23
TF_66 Pti5 99 9e-22
TF_2_5 AP2/EREBPDREB2A 98 9e-21
TF_65 Pti4 92 2e-19
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 76 2e-14

TOP