AGI ID: At4g18020

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: pseudo-response regulator 2 (APRR2)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At4g18020
MVITANDLSK WENFPKGLKV LLLLNGCDSD GDGSSAAETR SELESMDYIV TTFTDETEAL
SAVVKNPESF HIAIVEVNMS AESESFKFLE AAKDVLPTIM ISTDHCITTT MKCIALGAVE
FLQKPLSPEK LKNIWQHVVH KAFNDGGSNV SISLKPVKES VVSMLHLETD MTIEEKDPAP
STPQLKQDSR LLDGDCQENI NFSMENVNSS TEKDNMEDHQ DIGESKSVDT TNRKLDDDKV
VVKEERGDSE KEEEGETGDL ISEKTDSVDI HKKEDETKPI NKSSGIKNVS GNKTSRKKVD
WTPELHKKFV QAVEQLGVDQ AIPSRILELM KVGTLTRHNV ASHLQKFRQH RKNILPKDDH
NHRWIQSREN HRPNQRNYNV FQQQHRPVMA YPVWGLPGVY PPGAIPPLWP PPLQSIGQPP
PWHWKPPYPT VSGNAWGCPV GPPVTGSYIT PSNTTAGGFQ YPNGAETGFK IMPASQPDEE
MLDQVVKEAI SKPWLPLPLG LKPPSAESVL AELTRQGISA VPSSSCLING SHRLR
Length = 535 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At4g18020

>At4g18020 pseudo-response regulator 2 (APRR2)
          Length = 535

 Score = 97.1 bits (241), Expect = 2e-21
 Identities = 33/59 (55%), Positives = 46/59 (77%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRL 59
           + +V W+ ELH++FV AV QLGV++A+P +ILELM V  LTR NVASHLQK+R + + +
Sbjct: 296 RKKVDWTPELHKKFVQAVEQLGVDQAIPSRILELMKVGTLTRHNVASHLQKFRQHRKNI 354


InterPro Results:

IPR001005 Domain
PF00249 T[298-348] 1.6e-11 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[30-132] 1e-05 sp_Q9FJ16_ARATH_Q9FJ16;
PF00072 T[18-143] 0.0024 Response_reg
PS50110 T[43-139] 13.733 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[296-351] 4.4e-29 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[292-354] 5e-19 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[15-141] 3.1e-12 CheY-like
CheY-like
NULL
seg ?[244-258]?[401-429]?[492-504] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class 97 2e-21
TF_10_1 GARPG2-like 98 2e-20
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 73 6e-13
TF_1_2 MYB superfamilyLHY 66 5e-11

TOP