AGI ID: At4g17695

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: GARP-like putative transcription factor KANADI3 (KAN3)

Amino Acid Sequence:


1
61
121
181
241
301
>At4g17695
MELFPSQPDL YLKISRRREE EQEKESQELQ EQEVERRLGF QSKASDLDNK SSNNLIHTLQ
FTSNNEATKI NSNQEHKESL DQDLRSIFMM RPIRGIPLYQ NQVLDHYYYS STSPNPFFFS
EVNGQHASRR LITNPNCSFN LHNRHRRQAQ PQPPRFTAKR GVRAPRMRWT TTLHAHFVHA
VQLLGGHERA TPKSVLELMD VQDLTLAHVK SHLQMYRTIK STEKPTTSSG QSDCENGSQV
NSEREARNLT GLWNNSSSEA RFQLKAKASS GVDISSNENE WKNRRCPSNE RLSSDSSSLT
GTRPETETPN LDFTLATPNL SP
Length = 322 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At4g17695

>At4g17695 GARP-like putative transcription factor KANADI3 (KAN3)
          Length = 322

 Score =  105 bits (262), Expect = 9e-23
 Identities = 33/65 (50%), Positives = 41/65 (62%)

Query: 177 QPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHL 236
               A  G    R+RWT  LH  FV+AV  LGG ++ATPK +L+LM V  LT+ H+KSHL
Sbjct: 154 PRFTAKRGVRAPRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHL 213

Query: 237 QKYRL 241
           Q YR 
Sbjct: 214 QMYRT 218


InterPro Results:

IPR001005 Domain
PF00249 T[166-217] 4.5e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[164-220] 1.4e-26 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[160-224] 4.2e-17 Homeodomain-like
Homeodomain-like
NULL
coil ?[12-38] coiled-coil
seg ?[16-37]?[146-155]?[293-298] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like105 9e-23
TF_10_2 GARPARR-B class 82 4e-17
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 58 1e-08
TF_1_2 MYB superfamilyLHY 53 5e-07

TOP