AGI ID: At4g16110

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At4g16110
MVNPGHGRGP DSGTAAGGSN SDPFPANLRV LVVDDDPTCL MILERMLMTC LYREQRAHCL
CFGRTKNGFD IVISDVHMPD MDGFKLLEHV GLEMDLPVIN LNVLKPLVIV MSADDSKSVV
LKGVTHGAVD YLIKPVRIEA LKNIWQHVVR KKRNEWNVSE HSGGSIEDTG GDRDRQQQHR
EDADNNSSSV NEGNGRSSRK RKEEEVDDQG DDKEDSSSLK KPRVVWSVEL HQQFVAAVNQ
LGVDSELKTC LLMHLCVSIG NIVEFQKYRI YLRRLGGVSQ HQGNMNHSFM TGQDQSFGPL
SSLNGFDLQS LAVTGQLPPQ SLAQLQAAGL GRPTLAKPGM SVSPLVDQRS IFNFENPKIR
FGDGHGQTMN NGNLLHGVPT GSHMRLRPGQ NVQSSGMMLP VADQLPRGGP SMLPSLGQQP
ILSSSVSRRS DLTGALAVRN SIPETNSRVL PTTHSVFNNF PADLPRSSFP LASAPGISVP
VSVSYQEEVN SSDAKGGSSA ATAGFGNPSY DIFNDFPQHQ QHNKNISNKL NDWDLRNMGL
VFSSNQDAAT ATATAAFSTS EAYSSSSTQR KRRETDATVV GEHGQNLQSP SRNLYHLNHV
FMDGGSVRVK SERVAETVTC PPANTLFHEQ YNQEDLMSAF LKQV
Length = 644 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At4g16110

>At4g16110 hypothetical protein
          Length = 644

 Score = 90.9 bits (225), Expect = 1e-19
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 4/64 (6%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           KPRVVWSVELHQQFVAAVNQLGV+  +   +L  + V   +  N+    QKYRIYLRRLG
Sbjct: 221 KPRVVWSVELHQQFVAAVNQLGVDSELKTCLLMHLCV---SIGNIV-EFQKYRIYLRRLG 276

Query: 61  GVSQ 64
           GVSQ
Sbjct: 277 GVSQ 280


InterPro Results:

IPR001789 Domain
PD000039 T[29-141] 3e-59 sp_O23460_ARATH_O23460;
PF00072 T[28-153] 4.8e-14 Response_reg
SM00448 T[28-145] 2.5e-18 REC
PS50110 T[29-149] 20.393 RESPONSE_REGULATORY
Response regulator receiver
IPR009057 Domain
SSF46689 T[217-276] 1.1e-09 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[25-163] 2.5e-21 CheY-like
CheY-like
NULL
seg ?[315-333]?[543-568] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class 91 1e-19
TF_10_1 GARPG2-like 87 5e-17
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 65 9e-11
TF_1_2 MYB superfamilyLHY 53 4e-07

TOP