AGI ID: At4g14550

TF ID:TF_55
Super family:Aux/IAA
Sub family:
Gene name: IAA14

Amino Acid Sequence:


1
61
121
181
>At4g14550
MNLKETELCL GLPGGTETVE SPAKSGVGNK RGFSETVDLK LNLQSNKQGH VDLNTNGAPK
EKTFLKDPSK PPAKAQVVGW PPVRNYRKNV MANQKSGEAE EAMSSGGGTV AFVKVSMDGA
PYLRKVDLKM YTSYKDLSDA LAKMFSSFTM GSYGAQGMID FMNESKVMDL LNSSEYVPSY
EDKDGDWMLV GDVPWPMFVE SCKRLRIMKG SEAIGLAPRA MEKFKNRS
Length = 228 AA.

PSI BLAST Result:

Query: Query sequence of TF_55
Sbjct: At4g14550

>At4g14550 IAA14
          Length = 228

 Score =  274 bits (700), Expect = 3e-74
 Identities = 144/234 (61%), Positives = 170/234 (72%), Gaps = 17/234 (7%)

Query: 7   LNLRETELCLGLPGG-----DTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVT 61
           +NL+ETELCLGLPGG            GNKRGFSETVDLKLNL    +NK+G    D+ T
Sbjct: 1   MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQ---SNKQGHV--DLNT 55

Query: 62  FDSKEXXXXXXXXXXXXXXXQVVGWPLVRSYRKNVMVSCQK------SSGGPEAAAFVKV 115
             + +               QVVGWP VR+YRKNVM + +        S G    AFVKV
Sbjct: 56  NGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKV 115

Query: 116 SMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSW 175
           SMDGAPYLRK+DL+MY SY +LS+AL+ MFSSFTMG + G +GMIDFMNE K+MDL+NS 
Sbjct: 116 SMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSY-GAQGMIDFMNESKVMDLLNSS 174

Query: 176 DYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA 229
           +YVPSYEDKDGDWMLVGDVPWPMFV++CKRLR+MKGS+AIGLAPRAMEK K+R+
Sbjct: 175 EYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228


InterPro Results:

IPR003311 Family
PF02309 T[1-220] 4.1e-110 AUX_IAA
AUX/IAA protein
NULL
seg ?[96-108] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_55 Aux/IAA274 3e-74
TF_17_2 ARFNPH4/ARF7233 5e-61
TF_17_1 ARFMONOPTEROS/ARF5178 1e-44

TOP