AGI ID: At4g13640

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At4g13640
MYSAIRSSLP LDGSLGDYSD GTNLPIDACL VLTTDPKPRL RWTSELHERF VDAVTQLGGP
DKATPKTIMR TMGVKGLTLY HLKSHLQKFR LGRQSCKESI DNSKDVSCVA ESQDTGSSST
SSLRLAAQEQ NESYQVTEAL RAQMEVQRRL HEQLEVQRRL QLRIEAQGKY LQSILEKACK
AIEEQAVAFA GLEAAREELS ELAIKASITN GCQGTTSTFD TTKMMIPSLS ELAVAIEHKN
NCSAESSLTS STVGSPVSAA LMKKRQRGVF GNGDSVVVGH DAGWVMPSSS IG
Length = 292 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At4g13640

>At4g13640 unknown protein
          Length = 292

 Score =  112 bits (280), Expect = 7e-25
 Identities = 42/61 (68%), Positives = 48/61 (77%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           T   K RLRWT ELH RFV+AV  LGGPDKATPK I++ MGV GLT+YH+KSHLQK+RL 
Sbjct: 33  TTDPKPRLRWTSELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRLG 92

Query: 243 I 243
            
Sbjct: 93  R 93



 Score = 90.4 bits (223), Expect = 3e-18
 Identities = 24/43 (55%), Positives = 35/43 (80%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQE 427
           + EAL  QME+Q++LHEQLE QR+LQL +EA G+Y+ S++E+ 
Sbjct: 136 VTEALRAQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKA 178


InterPro Results:

IPR001005 Domain
PF00249 T[39-90] 3.9e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[37-93] 1.3e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[33-97] 6.3e-18 Homeodomain-like
Homeodomain-like
NULL
coil ?[137-158] coiled-coil
seg ?[117-122]?[190-203] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like112 7e-25
TF_10_2 GARPARR-B class 97 2e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 70 3e-12
TF_1_2 MYB superfamilyLHY 66 7e-11

TOP