AGI ID: At4g05630

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
>At4g05630
MANFPDKQYD SNNPYNIMIT LSPFDVDRST TIMMPKALLE TNLFPFMEIS TLVQLLQVQD
KPKMIGVYDI DTQITTYVII RQDGNNFKFH GWNDILKRKH YKAGDTIAFW WDLRHTRLNF
KHVA
Length = 124 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g05630

>At4g05630 hypothetical protein
          Length = 124

 Score = 93.4 bits (231), Expect = 1e-19
 Identities = 22/121 (18%), Positives = 36/121 (29%), Gaps = 16/121 (13%)

Query: 78  PARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAH-LPALE----------CKEGI 126
           P ++ D      +    L   DV     +++PK   E +  P +E            +  
Sbjct: 5   PDKQYDSNNPYNIM-ITLSPFDVDRSTTIMMPKALLETNLFPFMEISTLVQLLQVQDKPK 63

Query: 127 PIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYV 186
            I + D+D         R   NN           D +     + GD I  + DL      
Sbjct: 64  MIGVYDIDTQITTYVIIRQDGNNFKFH----GWNDILKRKHYKAGDTIAFWWDLRHTRLN 119

Query: 187 I 187
            
Sbjct: 120 F 120


Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 93 1e-19
TF_17_2 ARFNPH4/ARF7 81 4e-15
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 72 1e-12

TOP