AGI ID: At4g04580

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative protein

Amino Acid Sequence:


1
61
121
>At4g04580
MQDPMVRSYI RSDNPRMHWT DDLDIRFIQV IEKLGGEESA TPKRILSLMG VRDLTISHVK
SHLQMYRNKK KEESSKEIKM MREMTQRQSQ QYLQIYERAT QFIQNQQRLQ LDNTEKITPV
LGSSNKSLDQ SSKVGLNENR GNDVVVVGGA TGEEELSLEL TLGRKY
Length = 166 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At4g04580

>At4g04580 putative protein
          Length = 166

 Score = 97.4 bits (241), Expect = 3e-20
 Identities = 31/61 (50%), Positives = 38/61 (61%)

Query: 180 RAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKY 239
           R+       R+ WT +L  RF+  +  LGG + ATPK IL LMGV  LTI H+KSHLQ Y
Sbjct: 7   RSYIRSDNPRMHWTDDLDIRFIQVIEKLGGEESATPKRILSLMGVRDLTISHVKSHLQMY 66

Query: 240 R 240
           R
Sbjct: 67  R 67


InterPro Results:

IPR001005 Domain
PF00249 T[16-67] 2.3e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[14-70] 2.4e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[10-74] 2e-16 Homeodomain-like
Homeodomain-like
NULL
seg ?[69-84]?[144-163] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like 97 3e-20
TF_10_2 GARPARR-B class 77 2e-15
TF_1_2 MYB superfamilyLHY 72 8e-13
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 67 3e-11

TOP