AGI ID: At4g03170

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At4g03170
MANSTGKPTS STQEDEEATS ATEILAQLMQ DIIDREEDID DEDDIDDEVI DDEDYEVASL
PLLQESQANQ KQSREREEET EKNQPKRFKK QNMMKINIHD FSEETLRLIE VWYEAELDPQ
DIFGDNEVTR LFSRPIKKQL MSSDVDKDQC MLMLSKEQVK EKMLPFLEDS ENPVKGIDVS
VYGPDGKVQQ MEFKMWNGDK TPVLTSGWKQ FVEDYGLSMT CDFVTVWMFR HIKTRKLCFA
IHYVKFSLRD
Length = 250 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At4g03170

>At4g03170 hypothetical protein
          Length = 250

 Score =  123 bits (309), Expect = 6e-28
 Identities = 32/177 (18%), Positives = 57/177 (32%), Gaps = 14/177 (7%)

Query: 57  SMQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMG 116
           S +++ +   + P    K   M  N+       ++E    + +    + D   +   +  
Sbjct: 73  SREREEETEKNQPKRFKKQNMMKINIHDF----SEETLRLIEVWYEAELDPQDIFGDNEV 128

Query: 117 LKLNRQPNEFFCKTLTASDTST-HGGFSVPRRAA-EKIFPALDFSMQP-PCQELVAKDIH 173
            +L  +P     K L +SD         + +    EK+ P L+ S  P    ++      
Sbjct: 129 TRLFSRP---IKKQLMSSDVDKDQCMLMLSKEQVKEKMLPFLEDSENPVKGIDVSVYGPD 185

Query: 174 DNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRL-FAGDSVL---FIRDGKAQLLLGIR 226
                         K  +LT+GW  FV    L    D V    F      +L   I 
Sbjct: 186 GKVQQMEFKMWNGDKTPVLTSGWKQFVEDYGLSMTCDFVTVWMFRHIKTRKLCFAIH 242


InterPro Results:

NULL
coil ?[63-84] coiled-coil
seg ?[31-54] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7123 6e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 87 4e-17
TF_22_1 ABI3/VP1FUSCA3 81 5e-16

TOP