AGI ID: At4g03160

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At4g03160
MDDVTPDELE AVSVLLRLPN PVFFDQEEEE EDEEEEYDEE SVCEDDLEVK SCMQTNENKG
KKRKVAEQLM DSDVKDNQYR LMLGKEPVKK MMDALGKTEK LGTKGLNVSV YGPNGENHKM
VLKIWIKGTP VLTSGWKNFV KSYKLEKHVD FLTIWMFRHK KTREICFAID STRFPVKGTL
SKRILQEVFK NP
Length = 192 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At4g03160

>At4g03160 hypothetical protein
          Length = 192

 Score = 93.0 bits (230), Expect = 8e-19
 Identities = 21/147 (14%), Positives = 46/147 (31%), Gaps = 13/147 (8%)

Query: 86  ADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDT-STHGGFSV 144
            + + +E Y + ++   +       + S M    N+       + L  SD         +
Sbjct: 29  EEEDEEEEYDEESVCEDDLE-----VKSCMQTNENKGKKRKVAEQLMDSDVKDNQYRLML 83

Query: 145 PRRAAEKIFPALDFSMQ--PPCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVST 202
            +   +K+  AL  + +       +     +                 +LT+GW  FV +
Sbjct: 84  GKEPVKKMMDALGKTEKLGTKGLNVSVYGPNGENHKMVLKIWI-KGTPVLTSGWKNFVKS 142

Query: 203 KRLFAG-DSVL---FIRDGKAQLLLGI 225
            +L    D +    F      ++   I
Sbjct: 143 YKLEKHVDFLTIWMFRHKKTREICFAI 169


InterPro Results:

NULL
seg ?[25-46] seg
SSF55608 T[113-192] 3e-11 Homing endonucleases
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 93 8e-19
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 78 2e-14
TF_22_1 ABI3/VP1FUSCA3 74 9e-14

TOP