AGI ID: At4g02870

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g02870
MTLSDDPISP STQESSNSSY VRSKEAEKNS PSQETDEEVL KGYESYRENP SNYDNDNILI
YTDTFNLYDD MFEGSLDSTR NFGAQKDPNV LVMQRLLHNS GSLIGVDMEQ DGIDLATLFA
DSTEDSKLPY VIYEGLEMQG EGYGTNTRGP FENKIDIGSF GKSGSVMNVE REKEKIVMIP
TPRFGNATPQ WTIKKKLSSY DIRPRCGRLI LQSSSFNEHI GRHLPKDQMI KINVGVNVNV
YDYDTGTLHE LRLEYQRQYG LAHGWQEDFV RRRHLKQKDE IGLLWDFSSS RLQFGVISRN
TGPGLWETKD
Length = 310 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At4g02870

>At4g02870 hypothetical protein
          Length = 310

 Score =  100 bits (249), Expect = 6e-21
 Identities = 22/143 (15%), Positives = 41/143 (28%), Gaps = 12/143 (8%)

Query: 97  MTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTS-THGGFSVPR----RAAEK 151
            ++  V +     ++        N  P     K L++ D     G   +          +
Sbjct: 164 GSVMNVEREKEKIVMIPTPRF-GNATPQWTIKKKLSSYDIRPRCGRLILQSSSFNEHIGR 222

Query: 152 IFPALDFSMQPPCQELVAKDIH-DNTWTFRHIYRGQPKRHLLTTGWS-VFVSTKRLFAGD 209
             P            +   D         R  Y    +++ L  GW   FV  + L   D
Sbjct: 223 HLPKDQMIKINVGVNVNVYDYDTGTLHELRLEY---QRQYGLAHGWQEDFVRRRHLKQKD 279

Query: 210 SVLFIRD-GKAQLLLGIRRANRQ 231
            +  + D   ++L  G+   N  
Sbjct: 280 EIGLLWDFSSSRLQFGVISRNTG 302


InterPro Results:

NULL
seg ?[233-240] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7100 6e-21
TF_22_1 ABI3/VP1FUSCA3 86 2e-17
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 74 4e-13

TOP