AGI ID: At4g01580

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At4g01580
MVITRNMKAR ATSVSHRQSQ QDPESPVKKF FKLVLPSTMK DKMMRIPPRF VKLQGSKLSE
VVTLVTPAGY KRSIKLKRIG EEIWFHEGWS EFAEAHSIEE GHFLLFEYKK NSSFRVIIFN
ASACETNYPL DAVHIIDSDD DVIEITGKEF DTEHKSKKRP RDIEFDKILH DVDVMQVLKE
EEEDKRVLRG
Length = 190 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At4g01580

>At4g01580 hypothetical protein
          Length = 190

 Score = 99.2 bits (246), Expect = 8e-21
 Identities = 15/137 (10%), Positives = 40/137 (28%), Gaps = 9/137 (6%)

Query: 545 ASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARD 604
              M  +      RQ  +  ++      K++  S       + +P +       +L+   
Sbjct: 4   TRNMKARATSVSHRQSQQDPESPVKKFFKLVLPS-TMKDKMMRIPPRFV-----KLQGSK 57

Query: 605 GISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIR 664
              +           +++ +            E   +F + + ++EG F++         
Sbjct: 58  LSEVVTLVTPAGYKRSIKLKRIGEEIWFH---EGWSEFAEAHSIEEGHFLLFEYKKNSSF 114

Query: 665 GVKVRQPSGQKPEAPPS 681
            V +   S  +   P  
Sbjct: 115 RVIIFNASACETNYPLD 131


InterPro Results:

IPR003340 Family
PF02362 T[29-124] 1.2e-05 B3
Transcriptional factor B3

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 99 8e-21

TOP