AGI ID: At4g01500

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: putative DNA-binding protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g01500
MNLDQELAEI RASSSDHTNY FYSSERREHM FDKVLTPSDV GKLNRLVIPK QHAENFFPLE
DNQNGTVLDF QDKNGKMWRF RYSYWNSSQS YVMTKGWSRF VKEKKLFAGD TVSFYRGYIP
DDNAQPERRR KIMFIDWRPR AEINFVHNIN NHNFVFGSPT YPTARFYPVT PEYSMPYRSF
PPFYQNQFQE REYLGYGYGR VVNGNGVRYY AGSPLDQHHQ WNLGRSEPLV YDSVPVFPAG
RVPPSAPPQP STTKKLRLFG VDVEESSSSG DTRGEMGVAG YSSSSPVVIR DDDQSFWRSP
RGEMASSSSA MQLSDDEEYK RKGKSLEL
Length = 328 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At4g01500

>At4g01500 putative DNA-binding protein
          Length = 328

 Score =  195 bits (497), Expect = 5e-50
 Identities = 48/162 (29%), Positives = 71/162 (43%), Gaps = 13/162 (8%)

Query: 157 HMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYR 216
           HMF K LT SD        +P++ AE+ FP  D         L  +D +G  WRFR+ Y 
Sbjct: 29  HMFDKVLTPSDVGKLNRLVIPKQHAENFFPLEDNQNGTV---LDFQDKNGKMWRFRYSYW 85

Query: 217 GQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGD---DGKLRLGVRRASQIEGTAALSAQY 273
              + +++T GWS FV +KKL +GD V F RG    D       R+   I+        +
Sbjct: 86  NSSQSYVMTKGWSRFVKEKKLFAGDTVSFYRGYIPDDNAQPERRRKIMFIDWRPRAEINF 145

Query: 274 NQNMNHNNFSEVAHAISTHSVFSISYNPKASWSNFIIPAPKF 315
             N+N++NF   +    T       + P      + +P   F
Sbjct: 146 VHNINNHNFVFGSPTYPTAR-----FYPV--TPEYSMPYRSF 180


InterPro Results:

IPR003340 Family
PF02362 T[30-143] 3.8e-16 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[60-141] 0.00045 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[143-156]?[195-210] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3195 5e-50
TF_17_1 ARFMONOPTEROS/ARF5160 3e-39
TF_17_2 ARFNPH4/ARF7139 9e-33
TF_22_1 ABI3/VP1FUSCA3123 1e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3123 5e-28

TOP