AGI ID: At4g00260

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name:

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At4g00260
MLLQTIPVAF FLKYIEGRYE QKTAKLRSDA SKRTWEVKID GQRLTDGWKE FAVSHDLRIG
DIVVFRQESD LAFHVTLLGP SCCGIQYGSC SVEKNNLGDG ELCSVSGSSR NVRFPRGFVR
DNGVVGSGEI VLMNEKGRSW NFNLRQKPSN GTVYVRGGWV SFCDANGLKA GDNYTFKLIK
RAGTLVLRLL PNEPKEEANE VSLPEEPESD AERNLEKIQR KEKVKKNVTR EAESSSQDPS
CFVANVSPSS LRYDTLYLPK RFMRENGVDK RCGEMILINE KGKSWTLDLK VKKSSGTSLI
KRGWRSFCSA NGLRAGSIIT LKLIKKRATL VLRLIPNEPE EANEVVSLST EQESDEESIH
DEKISRRKSL LSENRFVTLT LTPYTIQSSL LNENLLCESM FQRLPVPFTR MNGINEETKM
TLLDKHGVKW LTTLRFEDDK RKRLRMVGGW QGFIQANDVK ANESIMLELI WEEETSCVLK
FCSKVKLEIK
Length = 490 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At4g00260

>At4g00260 
          Length = 490

 Score =  105 bits (263), Expect = 7e-23
 Identities = 19/170 (11%), Positives = 42/170 (24%), Gaps = 15/170 (8%)

Query: 533 ETQLPTM-----DRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIV 587
           E  LP       +R         +      R+               +  S +     + 
Sbjct: 200 EVSLPEEPESDAERNLEKIQRKEKVKKNVTREAE-SSSQDPSCFVANVSPSSLRYDT-LY 257

Query: 588 LPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNG 647
           LPK+    +             +      + W +  +   ++ +   +      F   NG
Sbjct: 258 LPKRFMREN----GVDKRCGEMILINEKGKSWTLDLKVKKSSGTS-LIKRGWRSFCSANG 312

Query: 648 LQEGDFIVIYSDVKL---IRGVKVRQPSGQKPEAPPSSAATKRQNKSQRN 694
           L+ G  I +    K    +  +   +P         S+     +      
Sbjct: 313 LRAGSIITLKLIKKRATLVLRLIPNEPEEANEVVSLSTEQESDEESIHDE 362



 Score = 76.9 bits (188), Expect = 4e-14
 Identities = 24/112 (21%), Positives = 37/112 (32%), Gaps = 13/112 (11%)

Query: 589 PKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGL 648
           P+     +        G    +      R WN   R  P+N + +Y+      F   NGL
Sbjct: 115 PRGFVRDN-----GVVGSGEIVLMNEKGRSWNFNLRQKPSNGT-VYVRGGWVSFCDANGL 168

Query: 649 QEGDFIVI---YSDVKLIRGVKVRQPSGQKPEA----PPSSAATKRQNKSQR 693
           + GD            L+  +   +P  +  E      P S A +   K QR
Sbjct: 169 KAGDNYTFKLIKRAGTLVLRLLPNEPKEEANEVSLPEEPESDAERNLEKIQR 220



 Score = 52.6 bits (125), Expect = 7e-07
 Identities = 14/152 (9%), Positives = 43/152 (28%), Gaps = 30/152 (19%)

Query: 534 TQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQ----SDVGNLG----- 584
           +     +    +    +       R+     +N    +   L      S + N       
Sbjct: 347 SLSTEQESDEESIHDEKI-----SRRKSLLSENR--FVTLTLTPYTIQSSLLNENLLCES 399

Query: 585 ---RIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGD 641
              R+ +P          +   +  +           W    RF  + + R+ ++     
Sbjct: 400 MFQRLPVP-------FTRMNGINEETKMTLLDKHGVKWLTTLRFEDDKRKRLRMVGGWQG 452

Query: 642 FVKTNGLQEGDFIVI---YSDVKL-IRGVKVR 669
           F++ N ++  + I++   + +    +     +
Sbjct: 453 FIQANDVKANESIMLELIWEEETSCVLKFCSK 484


InterPro Results:

IPR003340 Family
PF02362 T[1-83] 4e-14T[97-196] 5.5e-35T[241-341] 4.2e-43T[385-488] 1.3e-18 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[33-88] 1.4e-06 Cupredoxins
Cupredoxin
NULL
seg ?[388-399] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3105 7e-23
TF_17_2 ARFNPH4/ARF7104 2e-22
TF_22_1 ABI3/VP1FUSCA3101 6e-22

TOP