AGI ID: At3g62670

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At3g62670
MSVFSNILDE NSRNLRNEIP CDDGIASPIN DDDEEFLTKS NRVLLVGADS NSSLKNLMTQ
YSYQVTKYES GEEAMAFLMK NKHEIDLVIW DFHMPDINGL DALNIIGKQM DLPVVIMSHE
YKKETVMESI KYGACDFLVK PVSKEVIAVL WRHVYRKRMS KSGLDKPGES GTVESDPDEY
DDLEQDNLYE SNEEGSKNTC DHKEEKSPTK KPRMQWTPEL HHKFEVAVEK MGSLEKAFPK
TILKYMQEEL NVQGLTRNNV ASHLQKYRQS SKKTCTPQEP QEDFVWGNAG PDVTLAASKT
LLSSHATPSY LINNQAAPRG SYFMNNIPYP STSCLPVNNN NCFMTNPSTY IDQFQHQLQQ
QQQHQQYQST LNSISAMLTK QESRHVPSSA MENSEPLMIY NSNLPFGIDE CFPPAGFNIF
DQIGHN
Length = 426 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g62670

>At3g62670 putative protein
          Length = 426

 Score =  102 bits (255), Expect = 6e-22
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 182 ATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLM----GVDGLTIYHIKSHLQ 237
            +   K R++WTPELH++F  AV  +G  +KA PK ILK M     V GLT  ++ SHLQ
Sbjct: 206 KSPTKKPRMQWTPELHHKFEVAVEKMGSLEKAFPKTILKYMQEELNVQGLTRNNVASHLQ 265

Query: 238 KYRLNIRL 245
           KYR + + 
Sbjct: 266 KYRQSSKK 273


InterPro Results:

IPR001005 Domain
PF00249 T[213-268] 2.3e-09 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[54-150] 7e-50 sp_Q9LZJ8_ARATH_Q9LZJ8;
PF00072 T[41-158] 1.4e-09 Response_reg
SM00448 T[41-150] 1.4e-14 REC
PS50110 T[54-155] 22.956 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[211-271] 1.2e-19 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[207-274] 1.5e-15 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[38-164] 2.5e-22 CheY-like
CheY-like
NULL
seg ?[353-368] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like102 6e-22
TF_10_2 GARPARR-B class 90 2e-19
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 77 3e-14
TF_1_2 MYB superfamilyLHY 74 3e-13

TOP