AGI ID: At3g61970

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: RAV-like protein

Amino Acid Sequence:


1
61
121
181
241
>At3g61970
MNQEDKEKPI EEASSSMERE HMFDKVVTPS DVGKLNRLVI PKQHAERYFP LDNSTTNDSN
KGLLLNFEDR SGNSWRFRYS YWNSSQSYVM TKGWSRFVKD KKLDAGDIVS FQRDSCNKDK
LYIDWRRRPK IPDHHHQQFA GAMFPRFYTF PHPQMPTNYE THNLYHRFHQ RDLGIGYYVR
SMERSHPTAV IESVPVMMQR RAQVASMASR GEKRLRLFGV DMECGGGGGS VNSTEEESSS
SGGSIPRGRV SMVGAGSLLQ LRLVSSDDES LVAMEAASLE DHHFFTKKGK PSLSFDLDR
Length = 299 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At3g61970

>At3g61970 RAV-like protein
          Length = 299

 Score =  170 bits (432), Expect = 2e-42
 Identities = 40/133 (30%), Positives = 55/133 (41%), Gaps = 11/133 (8%)

Query: 131 QPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYS 190
                +          M          F K +T SD        +P++ AE+ FP LD S
Sbjct: 1   MNQEDKEKPIEEASSSM-----EREHMFDKVVTPSDVGKLNRLVIPKQHAERYFP-LDNS 54

Query: 191 A---QPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRD 247
                     L   D   N+W FR+ Y    + +++T GWS FV  K+L AGD V F RD
Sbjct: 55  TTNDSNKGLLLNFEDRSGNSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRD 114

Query: 248 E--KSQLMVGVRR 258
              K +L +  RR
Sbjct: 115 SCNKDKLYIDWRR 127


InterPro Results:

IPR003340 Family
PF02362 T[22-131] 1e-22 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[57-137] 0.0012 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[225-244] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5170 2e-42
TF_17_3 ARFETTIN/ARF3164 2e-40
TF_17_2 ARFNPH4/ARF7158 2e-38
TF_22_1 ABI3/VP1FUSCA3128 6e-30
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3125 1e-28

TOP