AGI ID: At3g61830

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor-like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At3g61830
MASVEGDDDF GSSSSRSYQD QLYTELWKVC AGPLVEVPRA QERVFYFPQG HMEQLVASTN
QGINSEEIPV FDLPPKILCR VLDVTLKAEH ETDEVYAQIT LQPEEDQSEP TSLDPPIVGP
TKQEFHSFVK ILTASDTSTH GGFSVLRKHA TECLPSLDMT QATPTQELVT RDLHGFEWRF
KHIFRGQPRR HLLTTGWSTF VSSKRLVAGD AFVFLRGENG DLRVGVRRLA RHQSTMPTSV
ISSQSMHLGV LATASHAVRT TTIFVVFYKP RISQFIVGVN KYMEAIKHGF SLGTRFRMRF
EGEESPERIF TGTIVGSGDL SSQWPASKWR SLQVQWDEPT TVQRPDKVSP WEIEPFLATS
PISTPAQQPQ SKCKRSRPIE PSVKTPAPPS FLYSLPQSQD SINASLKLFQ DPSLERISGG
YSSNNSFKPE TPPPPTNCSY RLFGFDLTSN SPAPIPQDKQ PMDTCGAAKC QEPITPTSMS
EQKKQQTSRS RTKVQMQGIA VGRAVDLTLL KSYDELIDEL EEMFEIQGQL LARDKWIVVF
TDDEGDMMLA GDDPWNEFCK MAKKIFIYSS DEVKKMTTKL KISSSLENEE YGNESFENRS
RG
Length = 602 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At3g61830

>At3g61830 auxin response factor-like protein
          Length = 602

 Score =  579 bits (1493), Expect = e-165
 Identities = 186/503 (36%), Positives = 267/503 (52%), Gaps = 25/503 (4%)

Query: 41  KDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYP 100
              S + +  + +ELW  CAGPLV +P+    V+YF QGH EQ+  ST +   ++     
Sbjct: 12  SSSSRSYQDQLYTELWKVCAGPLVEVPRAQERVFYFPQGHMEQLVASTNQGINSEEIPVF 71

Query: 101 NLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCK 160
           +LP +++C+V +VTL A+ ++DE+YAQ++LQP   + +   + D  ++  +K     F K
Sbjct: 72  DLPPKILCRVLDVTLKAEHETDEVYAQITLQPEEDQSEPTSL-DPPIVGPTKQEFHSFVK 130

Query: 161 TLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKR 220
            LTASDTSTHGGFSV R+ A +  P LD +   PTQELV RDLH   W F+HI+RGQP+R
Sbjct: 131 ILTASDTSTHGGFSVLRKHATECLPSLDMTQATPTQELVTRDLHGFEWRFKHIFRGQPRR 190

Query: 221 HLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGV 280
           HLLTTGWS FV SKRL AGD+ +F+R E   L VGVRR  R Q+ +P+SV+S+ SMH+GV
Sbjct: 191 HLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSVISSQSMHLGV 250

Query: 281 LXXXXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGK 340
           L          T F++FY PR   ++F++ + KY +AI     S+G RF M FE E+S +
Sbjct: 251 LATASHAVRTTTIFVVFYKPRI--SQFIVGVNKYMEAIKH-GFSLGTRFRMRFEGEESPE 307

Query: 341 RRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLT 400
           R + GTIVG  DL   +WP SKWR+LQV+WDEP    +P +VSPW+IE   +     +  
Sbjct: 308 RIFTGTIVGSGDLSS-QWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLATSPISTPA 366

Query: 401 SGLK---RQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRP 457
              +   ++  P   + +T         L +  DS N  +     PS+            
Sbjct: 367 QQPQSKCKRSRPIEPSVKTPAPPSFLYSLPQSQDSINASLKLFQDPSLERIS------GG 420

Query: 458 HNNQNVPSFMSEMQQNIVMGNGGLLGDMKMQQ-----PLMMNQKSEMVQPQNKLTVNPSA 512
           +++ N  SF  E        +  L G           P            +         
Sbjct: 421 YSSNN--SFKPETPPPPTNCSYRLFGFDLTSNSPAPIPQDKQPMDTCGAAK----CQEPI 474

Query: 513 SNTSGQEQNLSQSMSAPAKPENS 535
           + TS  EQ   Q+  +  K +  
Sbjct: 475 TPTSMSEQKKQQTSRSRTKVQMQ 497



 Score =  150 bits (380), Expect = 2e-36
 Identities = 67/274 (24%), Positives = 106/274 (38%), Gaps = 26/274 (9%)

Query: 631 PFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNIC------ 684
             I+ S D S+        S      WD      + D+ SP   +   A+  I       
Sbjct: 312 GTIVGSGDLSSQWPASKWRS--LQVQWDEPTTVQRPDKVSPWEIEPFLATSPISTPAQQP 369

Query: 685 MSNSTTSNILDPPL-SNTVLDDFCAIKDTDFQNHPSGCLVGN-----------NNTSFAQ 732
            S    S  ++P + +        ++  +    + S  L  +           +N SF  
Sbjct: 370 QSKCKRSRPIEPSVKTPAPPSFLYSLPQSQDSINASLKLFQDPSLERISGGYSSNNSFKP 429

Query: 733 DVQSQITSASFADSQAFSRQDFPDNXXXXXXXXXNVDFDDC-SLRQNSKGSSWQKIATPR 791
           +     T+ S+         + P                 C      +  S  +K  T R
Sbjct: 430 ETPPPPTNCSYRLFGFDLTSNSPAPIPQDKQPMDTCGAAKCQEPITPTSMSEQKKQQTSR 489

Query: 792 VRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYES 850
            R  TKVQ  G +VGR++D+T  K Y+EL   +E MF ++G L       W +V+ D E 
Sbjct: 490 SR--TKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLA--RDKWIVVFTDDEG 545

Query: 851 DVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEE 884
           D++L GDDPW EF    + I I S  EV++M+ +
Sbjct: 546 DMMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTK 579


InterPro Results:

IPR003311 Family
PF02309 T[395-579] 0.00016 AUX_IAA
AUX/IAA protein
IPR003340 Family
PF02362 T[127-232] 4.2e-11 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[254-333] 4.2e-52 Auxin_resp
Auxin response factor
NULL
seg ?[12-17] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5579 e-165
TF_17_2 ARFNPH4/ARF7554 e-158
TF_17_3 ARFETTIN/ARF3514 e-146
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3148 1e-35
TF_55 Aux/IAA134 4e-32
TF_22_1 ABI3/VP1FUSCA3111 7e-25

TOP