AGI ID: At3g53310

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At3g53310
MADDSELYPR FFKVFLVESA SESLMIPLPF MAFLADPLPK TVKLQGLGGK LWTVSLKKIS
GAAYLTRGWP KFAEEHELKN GEFMTFVYDG HRTFEVSVFD RWGSKEVRAE IQAIPLSDSD
SDSVVEDEKD STDVVEDDDD EDEDEDEDDD GSFDEDEEIS QSLYPIDEET ATDAAVFEGN
LDVEALTNPH FPTTLKNRIY ELLIPANVVK DNNLEFGSSI KYIDGEGTLV GLRGKWADKR
VCFKGWDRIC RRNRLKKHQD TVECELLHDD QKMVHSIRVH VLRRDA
Length = 286 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g53310

>At3g53310 unknown protein
          Length = 286

 Score = 79.6 bits (195), Expect = 6e-15
 Identities = 18/131 (13%), Positives = 34/131 (25%), Gaps = 18/131 (13%)

Query: 562 KPEKNLRFLLQKVLKQSDVGNLGRIVLPKK-EAETHLPELEARDGISLAMEDIGTSRVWN 620
             +  L     KV           I LP        LP+                 ++W 
Sbjct: 2   ADDSELYPRFFKVFLVESASESLMIPLPFMAFLADPLPK--------TVKLQGLGGKLWT 53

Query: 621 MRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIR------GVKVRQPSGQ 674
           +  +         YL      F + + L+ G+F+    D               ++   +
Sbjct: 54  VSLKKISGAA---YLTRGWPKFAEEHELKNGEFMTFVYDGHRTFEVSVFDRWGSKEVRAE 110

Query: 675 KPEAPPSSAAT 685
               P S + +
Sbjct: 111 IQAIPLSDSDS 121


InterPro Results:

IPR003340 Family
PF02362 T[10-104] 5.9e-09 B3
Transcriptional factor B3
NULL
seg ?[117-158] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 80 6e-15
TF_22_1 ABI3/VP1FUSCA3 41 7e-04

TOP