AGI ID: At3g49610

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g49610
MNRNHHDHLD AAGKDMWSRL SDLADKADML YEREGISKDR KSVSEEEEEK KTRFSILVDL
VGRLCDQEER RTLGSSPTKT NTLFEGSEKS HLDHHLDHLP QKPRSSLECF FTRVYTRRNH
NNVSTSSSLF NTDEFERTET KSPTIRNSQS SPSSCLMENT KRKRYQSSGK SKKPKFDPFS
LTAARETPEW LLDVMRKMKG AEGPIKLIYE KTLTATDVKP SESRLLIPFN KLLRNDFLTP
EESRAIAIDK EEEEEDTKKI GVKTIIVNQF SKEWSLRFLI WVMKKKKSGN GTLYYTLNRG
WNGVVSGNKL KANDNISLWT FRCGGVLCFA LEKE
Length = 334 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At3g49610

>At3g49610 putative protein
          Length = 334

 Score =  113 bits (284), Expect = 5e-25
 Identities = 29/196 (14%), Positives = 60/196 (29%), Gaps = 32/196 (16%)

Query: 58  MQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEV----YAQMTLQPVNKYDRDALLAS 113
            + ++  I +  + PS   C++ N        + +     +   +L    +   + LL  
Sbjct: 138 TETKSPTIRNSQSSPS--SCLMENTKRKRYQSSGKSKKPKFDPFSLTA-ARETPEWLLDV 194

Query: 114 DMGLKLNRQP-NEFFCKTLTASDTSTH-GGFSVPRRAAEK--IFPALDFS---------- 159
              +K    P    + KTLTA+D         +P     +       +            
Sbjct: 195 MRKMKGAEGPIKLIYEKTLTATDVKPSESRLLIPFNKLLRNDFLTPEESRAIAIDKEEEE 254

Query: 160 --MQPPCQELVAKDIHDNTWTFRHIYRGQPKR--------HLLTTGWSVFVSTKRLFAGD 209
              +    + +  +     W+ R +     K+        + L  GW+  VS  +L A D
Sbjct: 255 EDTKKIGVKTIIVNQFSKEWSLRFLIWVMKKKKSGNGTLYYTLNRGWNGVVSGNKLKAND 314

Query: 210 SVLFIRDG-KAQLLLG 224
           ++          L   
Sbjct: 315 NISLWTFRCGGVLCFA 330


InterPro Results:

IPR005508 Domain
PF03754 T[185-307] 3.9e-75 DUF313
Protein of unknown function DUF313
NULL
seg ?[45-51]?[251-255] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7113 5e-25
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3103 5e-22
TF_22_1 ABI3/VP1FUSCA3 93 2e-19

TOP