AGI ID: At3g46770

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At3g46770
MEENSSKKKL SETMSIQDTV LKFFRVYIPN QTADDMNLPL VSDKISGKPL PRKVTVKSVS
SGNIWRMEMK ANGNTVFLRD GWKKIVKDEN VTEPIFLEFE FDGYGVFHFC VYEYGSMCKR
MRSPMEKEVI KVDSEEDVLV GNEESTKGLE ESPRRGGTSR RRAKLKTKSH KIYEHLDNKL
NPSFPVDMTQ NRTRIPSLLI KDYNLTFPNM VIMRDKIGIL KRRIVIWKNR SVYLNGIGSI
IRRNHVKPGN EVVFELKMVN GYHGLVHEIK VHIIKA
Length = 276 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g46770

>At3g46770 putative protein
          Length = 276

 Score = 63.4 bits (153), Expect = 4e-10
 Identities = 18/112 (16%), Positives = 41/112 (36%), Gaps = 14/112 (12%)

Query: 568 RFLLQKVLKQSD-----VGNLGRIVLPKKEAET-HLPELEAR---DGISLAMED--IGTS 616
               +K L ++      V    R+ +P + A+  +LP +  +     +   +    + + 
Sbjct: 3   ENSSKKKLSETMSIQDTVLKFFRVYIPNQTADDMNLPLVSDKISGKPLPRKVTVKSVSSG 62

Query: 617 RVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKV 668
            +W M  +    N + ++L +     VK   + E  F+    D   +    V
Sbjct: 63  NIWRMEMK---ANGNTVFLRDGWKKIVKDENVTEPIFLEFEFDGYGVFHFCV 111


Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 63 4e-10

TOP