AGI ID: At3g46640

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g46640
MGEEVQMSDY DVSGDGDRVS EWEMGLPSDE DLASLSYSLI PPNLAMAFSI TPERSRTIQD
VNRASETTLS SLRGGSSGPN TSSSNNNVEE EDRVGSSSPG SDSKKQKTSN GDGDDGGGVD
PDSAMAAEEG DSGTEDLSGK TLKRPRLVWT PQLHKRFVDV VAHLGIKNAV PKTIMQLMNV
EGLTRENVAS HLQKYRLYLK RMQGLTNEGP SASDKLFSST PVPPQSFQDI GGGGGSSGNV
GVPIPGAYGT QQMMQMPVYA HHMGMQGYHH QNHNHDPYHQ NHRHHHGAGG NGAFESNPYM
MQQNKFGSMA SYPSVGGGSA NEN
Length = 323 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At3g46640

>At3g46640 putative protein
          Length = 323

 Score =  109 bits (274), Expect = 2e-25
 Identities = 39/63 (61%), Positives = 54/63 (84%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           +PR+VW+ +LH++FV  V  LG++ AVPK I++LMNV GLTRENVASHLQKYR+YL+R+ 
Sbjct: 144 RPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLKRMQ 203

Query: 61  GVS 63
           G++
Sbjct: 204 GLT 206


InterPro Results:

IPR001005 Domain
PF00249 T[146-196] 2e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[144-199] 8e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[140-203] 3.4e-20 Homeodomain-like
Homeodomain-like
NULL
seg ?[65-91]?[111-122]?[230-246]?[281-293] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class109 2e-25
TF_10_1 GARPG2-like109 5e-24
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 80 4e-15
TF_1_2 MYB superfamilyLHY 70 4e-12

TOP