AGI ID: At3g26790

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: FUSCA3 (FUS3)

Amino Acid Sequence:


1
61
121
181
241
301
>At3g26790
MMVDENVETK ASTLVASVDH GFGSGSGHDH HGLSASVPLL GVNWKKRRMP RQRRSSSSFN
LLSFPPPMPP ISHVPTPLPA RKIDPRKLRF LFQKELKNSD VSSLRRMILP KKAAEAHLPA
LECKEGIPIR MEDLDGFHVW TFKYRYWPNN NSRMYVLENT GDFVNAHGLQ LGDFIMVYQD
LYSNNYVIQA RKASEEEEVD VINLEEDDVY TNLTRIENTV VNDLLLQDFN HHNNNNNNNS
NSNSNKCSYY YPVIDDVTTN TESFVYDTTA LTSNDTPLDF LGGHTTTTNN YYSKFGTFDG
LGSVENISLD DFY
Length = 313 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At3g26790

>At3g26790 FUSCA3 (FUS3)
          Length = 313

 Score =  341 bits (875), Expect = 3e-94
 Identities = 233/312 (74%), Positives = 233/312 (74%)

Query: 1   MVDENVETKASTLVASVDXXXXXXXXXXXXXXXXXVPLLGVNWKKXXXXXXXXXXXXXXX 60
           MVDENVETKASTLVASVD                 VPLLGVNWKK               
Sbjct: 2   MVDENVETKASTLVASVDHGFGSGSGHDHHGLSASVPLLGVNWKKRRMPRQRRSSSSFNL 61

Query: 61  XXXXXXXXXXXXXXXXLPARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPAL 120
                           LPARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPAL
Sbjct: 62  LSFPPPMPPISHVPTPLPARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPAL 121

Query: 121 ECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDL 180
           ECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDL
Sbjct: 122 ECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDL 181

Query: 181 YSNNYVIQARKASXXXXXXXXXXXXXXXYTNLTRIENTVVNDLLLQDFXXXXXXXXXXXX 240
           YSNNYVIQARKAS               YTNLTRIENTVVNDLLLQDF            
Sbjct: 182 YSNNYVIQARKASEEEEVDVINLEEDDVYTNLTRIENTVVNDLLLQDFNHHNNNNNNNSN 241

Query: 241 XXXXKCSYYYPVIDDVTTNTESFVYDTTALTSNDTPLDFLGGHTTTTNNYYSKFGTFDGL 300
               KCSYYYPVIDDVTTNTESFVYDTTALTSNDTPLDFLGGHTTTTNNYYSKFGTFDGL
Sbjct: 242 SNSNKCSYYYPVIDDVTTNTESFVYDTTALTSNDTPLDFLGGHTTTTNNYYSKFGTFDGL 301

Query: 301 GSVENISLDDFY 312
           GSVENISLDDFY
Sbjct: 302 GSVENISLDDFY 313


InterPro Results:

IPR003340 Family
PF02362 T[91-196] 5.6e-25 B3
Transcriptional factor B3
NULL
seg ?[20-36]?[47-77]?[195-209]?[230-245] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3341 3e-94
TF_17_1 ARFMONOPTEROS/ARF5128 1e-29
TF_17_3 ARFETTIN/ARF3126 3e-29
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3120 3e-27
TF_17_2 ARFNPH4/ARF7 95 2e-19

TOP