AGI ID: At3g25790

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g25790
MIKNLSNMKN DNQKREKCCE YIEALEEERR KINVFQRELP LCVELVTQAI EAYKREISGT
STDNLYGQSE CSEQTTGECG RILDLFIPIK HSSTSIEEEV DDKDDDDEEH QSHETDIDFD
DKNMKSEWLK SVQLWNQSDA VVSNNRQDRS QEKTETLVEL IKINDEAAKK NNNIKSPVTT
SDGGSGGGGG RRGQRKNRRC WSQELHRRFL NALKQLGGPH VATPKQIRDI MKVDGLTNDE
VKSHLQKYRL HARRPSQTTP NNRNSQTQHF VVVGGIWVPQ TNHSTANAVN AVASGETTGI
YGPMVSSLPS EWPRHSNFGR KISEDRSRCS NNGFFRCSSP AMSCSTRTKT KDAKIIS
Length = 357 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g25790

>At3g25790 unknown protein
          Length = 357

 Score =  105 bits (262), Expect = 9e-23
 Identities = 37/64 (57%), Positives = 44/64 (67%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
            G  K+R  W+ ELH RF+NA+  LGGP  ATPK I  +M VDGLT   +KSHLQKYRL+
Sbjct: 192 RGQRKNRRCWSQELHRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDEVKSHLQKYRLH 251

Query: 243 IRLP 246
            R P
Sbjct: 252 ARRP 255


InterPro Results:

IPR001005 Domain
PF00249 T[198-249] 9.9e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[196-252] 6.7e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[192-256] 3.2e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[97-109]?[183-199] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like105 9e-23
TF_10_2 GARPARR-B class 97 1e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 62 1e-09
TF_1_2 MYB superfamilyLHY 56 9e-08

TOP