AGI ID: At3g25730

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: AP2 domain transcription factor

Amino Acid Sequence:


1
61
121
181
241
301
>At3g25730
MDAMSSVDES STTTDSIPAR KSSSPASLLY RMGSGTSVVL DSENGVEVEV EAESRKLPSS
RFKGVVPQPN GRWGAQIYEK HQRVWLGTFN EEDEAARAYD VAAHRFRGRD AVTNFKDTTF
EEEVEFLNAH SKSEIVDMLR KHTYKEELDQ RKRNRDGNGK ETTAFALASM VVMTGFKTAE
LLFEKTVTPS DVGKLNRLVI PKHQAEKHFP LPLGNNNVSV KGMLLNFEDV NGKVWRFRYS
YWNSSQSYVL TKGWSRFVKE KRLCAGDLIS FKRSNDQDQK FFIGWKSKSG LDLETGRVMR
LFGVDISLNA VVVVKETTEV LMSSLRCKKQ RVL
Length = 333 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At3g25730

>At3g25730 AP2 domain transcription factor
          Length = 333

 Score =  183 bits (465), Expect = 5e-46
 Identities = 43/175 (24%), Positives = 79/175 (44%), Gaps = 10/175 (5%)

Query: 59  QKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLK 118
           +++ +F+ ++    S+++ ML   T   + +  +       +    +     LAS + + 
Sbjct: 121 EEEVEFLNAHSK--SEIVDMLRKHTYKEELDQRKRNRDGNGKETTAFA----LASMVVMT 174

Query: 119 LNRQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPAL--DFSMQPPCQELVAKDIHDNT 176
             +     F KT+T SD        +P+  AEK FP    + ++      L  +D++   
Sbjct: 175 GFKTAELLFEKTVTPSDVGKLNRLVIPKHQAEKHFPLPLGNNNVSVKGMLLNFEDVNGKV 234

Query: 177 WTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIR--DGKAQLLLGIRRAN 229
           W FR+ Y    + ++LT GWS FV  KRL AGD + F R  D   +  +G +  +
Sbjct: 235 WRFRYSYWNSSQSYVLTKGWSRFVKEKRLCAGDLISFKRSNDQDQKFFIGWKSKS 289


InterPro Results:

IPR001471 Domain
PD001423 T[71-108] 2e-16 sp_Q9LS06_ARATH_Q9LS06;
PR00367 T[62-73] 2.8e-05T[82-98] 2.8e-05 ETHRSPELEMNT
PF00847 T[60-121] 3.2e-31 AP2
SM00380 T[61-122] 3.8e-28 AP2
Pathogenesis-related transcriptional factor and ERF
IPR003340 Family
PF02362 T[182-291] 3.1e-24 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[217-297] 0.0011 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[5-16] seg
SSF54171 T[60-118] 3.4e-19 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7183 5e-46
TF_17_1 ARFMONOPTEROS/ARF5168 2e-41
TF_17_3 ARFETTIN/ARF3160 3e-39
TF_22_1 ABI3/VP1FUSCA3119 1e-27
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3121 1e-27
TF_67 Pti6113 1e-25
TF_2_2 AP2/EREBPAINTEGUMENTA108 1e-23
TF_65 Pti4104 5e-23
TF_2_3 AP2/EREBPAPETALA2101 5e-22
TF_66 Pti5100 6e-22
TF_68 ERF 98 3e-21
TF_2_4 AP2/EREBPCBF1 97 5e-21
TF_2_5 AP2/EREBPDREB2A 78 6e-15
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 75 6e-14

TOP