AGI ID: At3g25183

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At3g25183
MTSMYYNHDH LTASGKNMWS NFYVLVDTAV MLYEEEKQRR KIVSEEEEET QKRIFCLFPR
KTRSSLVKRQ QKLSGFLTSA SSSLIDLNQF PSDSEIEDPL NHHQLLSSSC FIAADFETLQ
NPSSEPCSSL VLFDCKTAGS EKTETKDPPN PNFPCPLSLC LTENKNRKRR AVEQRKRTGG
VKKAKVAPFS QTARETPEWL VNVMRDMKEA KDAKLIFEKT LFVTDVNPTQ NRLSMPFNNL
LRNDFLTSVE SRIIDKDIKN DKKIGVGAIL VDQRCKKWGV MLKRWEMKKE SGPVESSALP
WNREALPLLS VSAKFLVSQL ETINWLINSY GDLSSGDYGV FFCLVTCSFY CLVKKIRIPL
YC
Length = 362 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At3g25183

>At3g25183 hypothetical protein
          Length = 362

 Score = 93.8 bits (232), Expect = 4e-19
 Identities = 14/98 (14%), Positives = 26/98 (26%), Gaps = 11/98 (11%)

Query: 102 VNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTS-THGGFSVPRRAAE---------- 150
             +   + L+     +K  +     F KTL  +D + T    S+P               
Sbjct: 192 TARETPEWLVNVMRDMKEAKDAKLIFEKTLFVTDVNPTQNRLSMPFNNLLRNDFLTSVES 251

Query: 151 KIFPALDFSMQPPCQELVAKDIHDNTWTFRHIYRGQPK 188
           +I      + +      +  D     W          K
Sbjct: 252 RIIDKDIKNDKKIGVGAILVDQRCKKWGVMLKRWEMKK 289


InterPro Results:

IPR005508 Domain
PF03754 T[194-305] 1.4e-57 DUF313
Protein of unknown function DUF313
NULL
coil ?[33-54] coiled-coil
seg ?[253-264] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 94 4e-19
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 81 3e-15
TF_22_1 ABI3/VP1FUSCA3 61 6e-10

TOP