AGI ID: At3g24850

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g24850
MSSMYHDYDH LTASGKGLWS KFYGLVDAAV LLYDEIQRRG KIVSEEESQK RIFCLFPRRK
RSSLVKRQQK LNGGFISFTS SSLIDLNQLP TDSEIEDPQT SDSQMKTLQN SSSEPCTSLV
LFDYKTAESE KMEAKTLQNP SSELCSSLVL SDYKMAESEK METKDPPNPL SLCLTGNTSR
KRRAVEERKR TGGFKKAKVA PFPGTARDTP KWLVKVMRDM KEAKDAKLIF EKTLFVTDIN
PTQNRLSMPF NNLLQNDFLT SVESRIIKED INNNKKIGVG AILVDQRSVK WGVMLKRWEL
KKESGKGSWN YNLICGWNDV VEANGLKEGD NISVWSFRCR GVLCFAMEQS SSSLALCLC
Length = 359 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At3g24850

>At3g24850 hypothetical protein
          Length = 359

 Score =  128 bits (322), Expect = 2e-29
 Identities = 21/142 (14%), Positives = 37/142 (25%), Gaps = 19/142 (13%)

Query: 102 VNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTS-THGGFSVPRRAAE---------- 150
             +     L+     +K  +     F KTL  +D + T    S+P               
Sbjct: 205 TARDTPKWLVKVMRDMKEAKDAKLIFEKTLFVTDINPTQNRLSMPFNNLLQNDFLTSVES 264

Query: 151 KIFPALDFSMQPPCQELVAKDIHDNTWTFRHIYR-------GQPKRHLLTTGWSVFVSTK 203
           +I      + +      +  D     W                   + L  GW+  V   
Sbjct: 265 RIIKEDINNNKKIGVGAILVDQRSVKWGVMLKRWELKKESGKGSWNYNLICGWNDVVEAN 324

Query: 204 RLFAGDSVLFIRDG-KAQLLLG 224
            L  GD++       +  L   
Sbjct: 325 GLKEGDNISVWSFRCRGVLCFA 346


InterPro Results:

IPR005508 Domain
PF03754 T[207-323] 1.9e-73 DUF313
Protein of unknown function DUF313
NULL
seg ?[266-277] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7128 2e-29
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3116 5e-26
TF_22_1 ABI3/VP1FUSCA3106 1e-23

TOP