AGI ID: At3g24650

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: abscisic acid-insensitive protein 3

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At3g24650
MKSLHVAANA GDLAEDCGIL GGDADDTVLM DGIDEVGREI WLDDHGGDNN HVHGHQDDDL
IVHHDPSIFY GDLPTLPDFP CMSSSSSSST SPAPVNAIVS SASSSSAASS STSSAASWAI
LRSDGEDPTP NQNQYASGNC DDSSGALQST ASMEIPLDSS QGFGCGEGGG DCIDMMETFG
YMDLLDSNEF FDTSAIFSQD DDTQNPNLMD QTLERQEDQV VVPMMENNSG GDMQMMNSSL
EQDDDLAAVF LEWLKNNKET VSAEDLRKVK IKKATIESAA RRLGGGKEAM KQLLKLILEW
VQTNHLQRRR TTTTTTNLSY QQSFQQDPFQ NPNPNNNNLI PPSDQTCFSP STWVPPPPQQ
QAFVSDPGFG YMPAPNYPPQ PEFLPLLESP PSWPPPPQSG PMPHQQFPMP PTSQYNQFGD
PTGFNGYNMN PYQYPYVPAG QMRDQRLLRL CSSATKEARK KRMARQRRFL SHHHRHNNNN
NNNNNNQQNQ TQIGETCAAV APQLNPVATT ATGGTWMYWP NVPAVPPQLP PVMETQLPTM
DRAGSASAMP RQQVVPDRRQ GWKPEKNLRF LLQKVLKQSD VGNLGRIVLP KKEAETHLPE
LEARDGISLA MEDIGTSRVW NMRYRFWPNN KSRMYLLENT GDFVKTNGLQ EGDFIVIYSD
VKCGKYLIRG VKVRQPSGQK PEAPPSSAAT KRQNKSQRNI NNNSPSANVV VASPTSQTVK
Length = 720 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g24650

>At3g24650 abscisic acid-insensitive protein 3
          Length = 720

 Score = 1061 bits (2744), Expect = 0.0
 Identities = 558/720 (77%), Positives = 559/720 (77%), Gaps = 5/720 (0%)

Query: 1   MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLXXXXXXXXXXXXXXXXXL 60
           MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWL                 L
Sbjct: 1   MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDL 60

Query: 61  IVHHDPSIFYGDLPTLPDFPCMXXXXXXXXXPAPVNAIVXXXXXXXXXXXXXXXXXXWAI 120
           IVHHDPSIFYGDLPTLPDFPCM         PAPVNAIV                  WAI
Sbjct: 61  IVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAI 120

Query: 121 LRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQXXXXXXXXXDCIDMMETFG 180
           LRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQ         DCIDMMETFG
Sbjct: 121 LRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFG 180

Query: 181 YMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMLENNSGGDMQMMNSSL 240
           YMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPM+ENNSGGDMQMMNSSL
Sbjct: 181 YMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSL 240

Query: 241 EQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEW 300
           EQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEW
Sbjct: 241 EQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEW 300

Query: 301 VQTNHLQXXXXXXXXXNLSYXXXXXXXXXXXXXXXXXXXXXXXXQTCFSPSTWVPPPPQQ 360
           VQTNHLQ         NLSY                        QTCFSPSTWVPPPPQQ
Sbjct: 301 VQTNHLQRRRTTTTTTNLSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQ 360

Query: 361 QAFVSDPGFGYMPAPNYXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFPMPPTSQYNQFGD 420
           QAFVSDPGFGYMPAPNY                            QFPMPPTSQYNQFGD
Sbjct: 361 QAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPPTSQYNQFGD 420

Query: 421 PTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRH-XXX 479
           PTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRH    
Sbjct: 421 PTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNN 480

Query: 480 XXXXXXXXXXTQIGETCAAVAPQLNPVATTATGGTWMYWXXXXXXXXXXXXXMETQLPTM 539
                     TQIGETCAAVAPQLNPVATTATGGTWMYW             METQLPTM
Sbjct: 481 NNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTM 540

Query: 540 DRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPE 599
           DRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPE
Sbjct: 541 DRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPE 600

Query: 600 LEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSD 659
           LEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSD
Sbjct: 601 LEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSD 660

Query: 660 ----VKLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNIXXXXXXXXXXXXXXTSQTVK 715
                 LIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNI              TSQTVK
Sbjct: 661 VKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK 720


InterPro Results:

IPR003340 Family
PF02362 T[571-676] 1.8e-21 B3
Transcriptional factor B3
NULL
seg ?[43-59]?[83-91]?[100-117]?[162-170]?[308-316]?[321-344]?[378-405]?[477-490]?[520-532]?[701-714] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3061 0.0
TF_17_1 ARFMONOPTEROS/ARF5157 3e-38
TF_17_3 ARFETTIN/ARF3147 2e-35
TF_22_1 ABI3/VP1FUSCA3122 2e-28
TF_17_2 ARFNPH4/ARF7111 2e-24

TOP