AGI ID: At3g24120

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: transfactor like protein

Amino Acid Sequence:


1
61
121
181
241
>At3g24120
MYSAIRSLPL DGGHVGGDYH GPLDGTNLPG DACLVLTTDP KPRLRWTTEL HERFVDAVTQ
LGGPDKATPK TIMRTMGVKG LTLYHLKSHL QKFRLGRQAG KESTENSKDA SCVGESQDTG
SSSTSSMRMA QQEQNEGYQV TEALRAQMEV QRRLHDQLEV QRRLQLRIEA QGKYLQSILE
KACKAFDEQA ATFAGLEAAR EELSELAIKV SNSSQGTSVP YFDATKMMMM PSLSELAVAI
DNKNNITTNC SVESSLTSIT HGSSISAASM KKRQRGDNLG VGYESGWIMP SSTIG
Length = 295 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g24120

>At3g24120 transfactor like protein
          Length = 295

 Score =  112 bits (280), Expect = 8e-25
 Identities = 42/61 (68%), Positives = 48/61 (77%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           T   K RLRWT ELH RFV+AV  LGGPDKATPK I++ MGV GLT+YH+KSHLQK+RL 
Sbjct: 37  TTDPKPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRLG 96

Query: 243 I 243
            
Sbjct: 97  R 97



 Score = 88.1 bits (217), Expect = 1e-17
 Identities = 23/43 (53%), Positives = 35/43 (80%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQE 427
           + EAL  QME+Q++LH+QLE QR+LQL +EA G+Y+ S++E+ 
Sbjct: 140 VTEALRAQMEVQRRLHDQLEVQRRLQLRIEAQGKYLQSILEKA 182


InterPro Results:

IPR001005 Domain
PF00249 T[43-94] 1.8e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[41-97] 1.7e-29 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[37-101] 1e-17 Homeodomain-like
Homeodomain-like
NULL
coil ?[141-162] coiled-coil
seg ?[121-126]?[194-207] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like112 8e-25
TF_10_2 GARPARR-B class 97 2e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 71 2e-12
TF_1_2 MYB superfamilyLHY 65 1e-10

TOP