AGI ID: At3g19185

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At3g19185
MVESELSYEQ IRLNRVEENK KRMGELNLNK LAQSLRVSSS SSSSSKPSPA KPRTMRIPVD
FSEVRRSSRA KELSDPYSQF GLEPLERRPR RSSRRRDLLN RVYASDDARM YAFDRAEKLQ
SSLDSEYASF TKPMLQSHVT GGFWLGLPLP FCKAHMPKRD VIMTLVDEEE EESQAKYLAQ
KNGLSGGWRG FAIDHQLVDG DAVVFHLIAR TTFKVYIIRV NDDANNDSDG NEVNDDDSDG
NEEDRDNDNE SNEKQKETVS EGRQLRSSGK RKRRGRK
Length = 277 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g19185

>At3g19185 hypothetical protein
          Length = 277

 Score = 87.7 bits (216), Expect = 2e-17
 Identities = 18/145 (12%), Positives = 44/145 (29%), Gaps = 17/145 (11%)

Query: 557 RRQGWKPEKNLRF-LLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGT 615
           R +  +   +  +    K + QS V     + LP    + H+P+ +      +       
Sbjct: 115 RAEKLQSSLDSEYASFTKPMLQSHVTGGFWLGLPLPFCKAHMPKRD-----VIMTLVDEE 169

Query: 616 SRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPS--- 672
                 + ++         L      F   + L +GD +V +   +    V + + +   
Sbjct: 170 EEE--SQAKYLAQKNG---LSGGWRGFAIDHQLVDGDAVVFHLIARTTFKVYIIRVNDDA 224

Query: 673 ---GQKPEAPPSSAATKRQNKSQRN 694
                  E     +    +++   N
Sbjct: 225 NNDSDGNEVNDDDSDGNEEDRDNDN 249


InterPro Results:

IPR003340 Family
PF02362 T[129-223] 2.4e-25 B3
Transcriptional factor B3
NULL
seg ?[38-45]?[82-96]?[225-253]?[266-277] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 88 2e-17

TOP