AGI ID: At3g19070

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g19070
MTNLDEFLEE LSSIESHSQK IVKIDEHLKK LDEETKEDED EDAAKIIQDR STAREAEIAL
LMDLRQNFLP PPSMSSSSLQ PPSSSTLAPS SSSSLQPPAP LIDFFRSSVS YSHQPPSSST
LATSSSPSLQ PPSMSSSSLQ PPASLREFFT SSVSYSHQPS SSSTLATSSF FPSSMPYSVR
PPDSSDRPSL REFFPSSPSS SIQPPESSSS KRARLSNIFP SPLSSSPSPF VNPFLRPQAQ
EPTIPNFINP IPQISPGLPA LFPNPNPNPN PNPIPNPIRN PDLVWTNRLQ LVFDDAVVRL
GGLFSATPKA INELISEEGL TGDQIRSHLQ VLRDRQKAIA DKLALE
Length = 346 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g19070

>At3g19070 hypothetical protein
          Length = 346

 Score = 74.3 bits (181), Expect = 2e-13
 Identities = 26/63 (41%), Positives = 31/63 (48%)

Query: 178 PQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQ 237
           P           L WT  L   F +AV  LGG   ATPK I +L+  +GLT   I+SHLQ
Sbjct: 271 PNPIPNPIRNPDLVWTNRLQLVFDDAVVRLGGLFSATPKAINELISEEGLTGDQIRSHLQ 330

Query: 238 KYR 240
             R
Sbjct: 331 VLR 333


InterPro Results:

IPR006447 Domain
TIGR01557 T[280-336] 1.5e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[276-340] 5.8e-11 Homeodomain-like
Homeodomain-like
NULL
coil ?[14-42] coiled-coil
seg ?[25-45]?[69-101]?[107-145]?[151-174]?[180-189]?[195-210]?[215-235]?[263-281] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like 74 2e-13
TF_10_2 GARPARR-B class 67 1e-12

TOP