AGI ID: At3g18990

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
>At3g18990
MDSAHNHFKR ARLFEDLEDE DAEVIFPSSV YPSPLPESTV PANKGYASSA IQTLFTGPVK
AEEPTPTPKI PKKRGRKKKN ADPEEINSSA PRDDDPENRS KFYESASARK RTVTAEERER
AINAAKTFEP TNPFFRVVLR PSYLYRGCIM YLPSGFAEKY LSGISGFIKV QLAEKQWPVR
CLYKAGRAKF SQGWYEFTLE NNLGEGDVCV FELLRTRDFV LKVTAFRVNE YV
Length = 232 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g18990

>At3g18990 unknown protein
          Length = 232

 Score = 94.6 bits (234), Expect = 2e-19
 Identities = 29/140 (20%), Positives = 45/140 (31%), Gaps = 12/140 (8%)

Query: 536 LPTMDRAGSASAMPRQQVVPDRRQ---GWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKE 592
                   SASA  R     +R +     K  +      + VL+ S +     + LP   
Sbjct: 97  ENRSKFYESASARKRTVTAEERERAINAAKTFEPTNPFFRVVLRPSYLYRGCIMYLPSGF 156

Query: 593 AETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGD 652
           AE +L       GIS  ++     + W +R  +           +   +F   N L EGD
Sbjct: 157 AEKYL------SGISGFIKVQLAEKQWPVRCLYKAGRAKF---SQGWYEFTLENNLGEGD 207

Query: 653 FIVIYSDVKLIRGVKVRQPS 672
             V          +KV    
Sbjct: 208 VCVFELLRTRDFVLKVTAFR 227


InterPro Results:

IPR003340 Family
PF02362 T[134-231] 8e-13 B3
Transcriptional factor B3
NULL
seg ?[64-79] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 95 2e-19
TF_22_1 ABI3/VP1FUSCA3 79 4e-15

TOP