AGI ID: At3g18960

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At3g18960
MVTTQNTKAR VTSVSHRRSQ QDPESPVKKF FKLVLPSTMK DKMMQKIPPR FVKLQGSKLS
EVVTLETPAG FKRSIKLKRI GEEIWFHEGW SEFAEAHSIE EGHFLLFEYK ENSSFRVIIF
NVSACETKYP LDAVHIIDSD DDIIDITGKE FVGTQGTRKN NQSVNGGDTE HKSKKRSRDI
ELDKILHDLD VMNPMHVLKE EEEDKRVFRG
Length = 210 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g18960

>At3g18960 hypothetical protein
          Length = 210

 Score = 96.5 bits (239), Expect = 5e-20
 Identities = 13/138 (9%), Positives = 43/138 (30%), Gaps = 8/138 (5%)

Query: 544 SASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEAR 603
           +      +      R+  +  ++      K++  S + +     +P +       +L+  
Sbjct: 3   TTQNTKARVTSVSHRRSQQDPESPVKKFFKLVLPSTMKDKMMQKIPPRFV-----KLQGS 57

Query: 604 DGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLI 663
               +   +       +++ +            E   +F + + ++EG F++        
Sbjct: 58  KLSEVVTLETPAGFKRSIKLKRIGEEIWFH---EGWSEFAEAHSIEEGHFLLFEYKENSS 114

Query: 664 RGVKVRQPSGQKPEAPPS 681
             V +   S  + + P  
Sbjct: 115 FRVIIFNVSACETKYPLD 132


InterPro Results:

NULL
seg ?[136-146] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 97 5e-20

TOP