AGI ID: At3g17010

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g17010
MGKSSNIVFD RIKEERQMLS FFKIFQRADL SSDCMRALPY SFISKVSEKD FSYKMVIRAQ
WGKTWDVEVS KNPTYYYIET RGWDLFVSDN ALGQNEFITF THRGNMVFHV NIYEQNGLEM
RKPRKFQTMG PSSGIKKEEG ENSLIDVKKE EESDESPGRA EFLVRKKKTE DSKSSKKKMT
RNKVKKKSKS KSKQVLDGVP EFKITIRKSY LKFLAIPKHF VDDHIPNKSK IFTIRHPNGG
SWKVLCLVRE IRTIFSGGYS KLAREFPLMV GDKCTFKLIK PFEFVLLTSK KNREKMDQCM
ID
Length = 302 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g17010

>At3g17010 hypothetical protein
          Length = 302

 Score = 85.0 bits (209), Expect = 2e-16
 Identities = 18/122 (14%), Positives = 39/122 (31%), Gaps = 16/122 (13%)

Query: 569 FLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPN 628
               K+ +++D+ +     LP         +  +       +      + W++       
Sbjct: 19  LSFFKIFQRADLSSDCMRALPYSFISKVSEKDFSYK----MVIRAQWGKTWDVEVSK--- 71

Query: 629 NKSRMYL-LENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKV--------RQPSGQKPEAP 679
           N +  Y+       FV  N L + +FI       ++  V +        R+P   +   P
Sbjct: 72  NPTYYYIETRGWDLFVSDNALGQNEFITFTHRGNMVFHVNIYEQNGLEMRKPRKFQTMGP 131

Query: 680 PS 681
            S
Sbjct: 132 SS 133



 Score = 52.6 bits (125), Expect = 7e-07
 Identities = 18/139 (12%), Positives = 39/139 (27%), Gaps = 11/139 (7%)

Query: 537 PTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETH 596
            T D   S   M R +V    +   K   +     +  +++S +     + +PK   + H
Sbjct: 168 KTEDSKSSKKKMTRNKVKKKSKSKSKQVLDGVPEFKITIRKSYLK---FLAIPKHFVDDH 224

Query: 597 LPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVI 656
           +P     +   +          W +        + R           +   L  GD    
Sbjct: 225 IP-----NKSKIFTIRHPNGGSWKV---LCLVREIRTIFSGGYSKLAREFPLMVGDKCTF 276

Query: 657 YSDVKLIRGVKVRQPSGQK 675
                    +   + + +K
Sbjct: 277 KLIKPFEFVLLTSKKNREK 295


InterPro Results:

IPR003340 Family
PF02362 T[20-118] 1.2e-05T[201-294] 6.7e-18 B3
Transcriptional factor B3
NULL
seg ?[166-193] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 85 2e-16
TF_22_1 ABI3/VP1FUSCA3 62 5e-10

TOP