AGI ID: At3g16857

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: ARR1 protein, putative, 5' partial

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At3g16857
LEHVGLEMDL PVIMMSADDS KSVVLKGVTH GAVDYLIKPV RMEALKNIWQ HVVRKRRSEW
SVPEHSGSIE ETGERQQQQH RGGGGGAAVS GGEDAVDDNS SSVNEGNNWR SSSRKRKDEE
GEEQGDDKDE DASNLKKPRV VWSVELHQQF VAAVNQLGVE KAVPKKILEL MNVPGLTREN
VASHLQKYRI YLRRLGGVSQ HQGNLNNSFM TGQDASFGPL STLNGFDLQA LAVTGQLPAQ
SLAQLQAAGL GRPAMVSKSG LPVSSIVDER SIFSFDNTKT RFGEGLGHHG QQPQQQPQMN
LLHGVPTGLQ QQLPMGNRMS IQQQIAAVRA GNSVQNNGML MPLAGQQSLP RGPPPMLTSS
QSSIRQPMLS NRISERSGFS GRNNIPESSR VLPTSYTNLT TQHSSSSMPY NNFQPELPVN
SFPLASAPGI SVPVRKATSY QEEVNSSEAG FTTPSYDMFT TRQNDWDLRN IGIAFDSHQD
SESAAFSASE AYSSSSMSRH NTTVAATEHG RNHQQPPSGM VQHHQVYADG NGGSVRVKSE
RVATDTATMA FHEQYSNQED LMSALLKQV
Length = 569 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At3g16857

>At3g16857 ARR1 protein, putative, 5' partial
          Length = 569

 Score =  120 bits (302), Expect = 1e-28
 Identities = 64/64 (100%), Positives = 64/64 (100%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG
Sbjct: 137 KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 196

Query: 61  GVSQ 64
           GVSQ
Sbjct: 197 GVSQ 200


InterPro Results:

IPR001005 Domain
PF00249 T[139-189] 9.2e-13 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[1-45] 2e-17 sp_Q9ZWK0_ARATH_Q9ZWK0;
PS50110 T[1-53] 13.124 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[137-192] 1.6e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[133-196] 6.7e-22 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[9-71] 3.2e-10 CheY-like
CheY-like
NULL
seg ?[70-93]?[117-131]?[235-251]?[287-298]?[481-498] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class120 1e-28
TF_10_1 GARPG2-like119 7e-27
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 90 3e-18
TF_1_2 MYB superfamilyLHY 73 4e-13

TOP