AGI ID: At3g15540

TF ID:TF_55
Super family:Aux/IAA
Sub family:
Gene name: early auxin-induced protein, IAA19

Amino Acid Sequence:


1
61
121
181
>At3g15540
MEKEGLGLEI TELRLGLPGR DVAEKMMKKR AFTEMNMTSS GSNSDQCESG VVSSGGDAEK
VNDSPAAKSQ VVGWPPVCSY RKKNSCKEAS TTKVGLGYVK VSMDGVPYLR KMDLGSSQGY
DDLAFALDKL FGFRGIGVAL KDGDNCEYVT IYEDKDGDWM LAGDVPWGMF LESCKRLRIM
KRSDATGFGL QPRGVDE
Length = 197 AA.

PSI BLAST Result:

Query: Query sequence of TF_55
Sbjct: At3g15540

>At3g15540 early auxin-induced protein, IAA19
          Length = 197

 Score =  215 bits (548), Expect = 1e-56
 Identities = 93/225 (41%), Positives = 119/225 (52%), Gaps = 30/225 (13%)

Query: 2   MGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVT 61
           M    L L  TEL LGLPG D VA     KR F+E     +N+ +  +N +   +  V +
Sbjct: 1   MEKEGLGLEITELRLGLPGRD-VAEKMMKKRAFTE-----MNMTSSGSNSDQCESGVVSS 54

Query: 62  FDSKEXXXXXXXXXXXXXXXQVVGWPLVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAP 121
               E               QVVGWP V SYRK    SC+++S       +VKVSMDG P
Sbjct: 55  GGDAE-----KVNDSPAAKSQVVGWPPVCSYRKKN--SCKEASTTKVGLGYVKVSMDGVP 107

Query: 122 YLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSY 181
           YLRK+DL   + YD+L+ AL  +F    +G                L D  N  +YV  Y
Sbjct: 108 YLRKMDLGSSQGYDDLAFALDKLFGFRGIGVA--------------LKDGDN-CEYVTIY 152

Query: 182 EDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDA--IGLAPRAMEK 224
           EDKDGDWML GDVPW MF+++CKRLR+MK SDA   GL PR +++
Sbjct: 153 EDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE 197


InterPro Results:

IPR003311 Family
PF02309 T[6-191] 1.1e-90 AUX_IAA
AUX/IAA protein

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_55 Aux/IAA215 1e-56
TF_17_2 ARFNPH4/ARF7218 2e-56
TF_17_1 ARFMONOPTEROS/ARF5169 8e-42

TOP