AGI ID: At3g15210

TF ID:TF_2_2
Super family:AP2/EREBP
Sub family:AINTEGUMENTA
Gene name: ethylene responsive element binding factor 4

Amino Acid Sequence:


1
61
121
181
>At3g15210
MAKMGLKPDP ATTNQTHNNA KEIRYRGVRK RPWGRYAAEI RDPGKKTRVW LGTFDTAEEA
ARAYDTAARD FRGAKAKTNF PTFLELSDQK VPTGFARSPS QSSTLDCASP PTLVVPSATA
GNVPPQLELS LGGGGGGSCY QIPMSRPVYF LDLMGIGNVG RGQPPPVTSA FRSPVVHVAT
KMACGAQSDS DSSSVVDFEG GMEKRSQLLD LDLNLPPPSE QA
Length = 222 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_2
Sbjct: At3g15210

>At3g15210 ethylene responsive element binding factor 4
          Length = 222

 Score =  149 bits (375), Expect = 5e-36
 Identities = 41/167 (24%), Positives = 64/167 (37%), Gaps = 8/167 (4%)

Query: 367 EYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFGTQEEAAEAY 426
           +       ++   ++    YRGV R    GR+ A I        ++LGTF T EEAA AY
Sbjct: 7   KPDPATTNQTHNNAKEI-RYRGV-RKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAY 64

Query: 427 DVAAIKFRGTNAVTNFDITRYDVDRIMSSNTLLSGELARRNNNSIVVRNTEDQTALNAVV 486
           D AA  FRG  A TNF          +S   + +G     + +S +   +     + +  
Sbjct: 65  DTAARDFRGAKAKTNFPTFLE-----LSDQKVPTGFARSPSQSSTLDCASPPTLVVPSAT 119

Query: 487 EGGSNKEVSTPERLLSFPAIFALPQVNQKMFGSNMG-GNMSPWTSNP 532
            G    ++          + + +P      F   MG GN+      P
Sbjct: 120 AGNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPP 166



 Score =  109 bits (272), Expect = 4e-24
 Identities = 30/107 (28%), Positives = 43/107 (40%), Gaps = 9/107 (8%)

Query: 266 KQIVHRKSIDTFGQRTSQYRGVTRHRWTGRYEAHLWDNSFKKEGHSRKGRQVYLGGYDME 325
           K      +      +  +YRGV +  W GRY A + D          K  +V+LG +D  
Sbjct: 7   KPDPATTNQTHNNAKEIRYRGVRKRPW-GRYAAEIRDPG--------KKTRVWLGTFDTA 57

Query: 326 EKAARAYDLAALKYWGPSTHTNFSAENYQKEIEDMKNMTRQEYVAHL 372
           E+AARAYD AA  + G    TNF       + +      R    +  
Sbjct: 58  EEAARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSST 104


InterPro Results:

IPR001471 Domain
PD001423 T[31-54] 3e-08 sp_Q8S2S7_THEHA_Q8S2S7;
PR00367 T[25-36] 8.9e-13T[47-63] 8.9e-13 ETHRSPELEMNT
PF00847 T[23-86] 2.5e-41 AP2
SM00380 T[24-87] 4.8e-37 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[55-69]?[132-137]?[188-197]?[208-218] seg
SSF54171 T[23-84] 3.8e-24 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_2 AP2/EREBPAINTEGUMENTA149 5e-36
TF_68 ERF130 6e-31
TF_2_4 AP2/EREBPCBF1127 3e-30
TF_67 Pti6122 2e-28
TF_2_3 AP2/EREBPAPETALA2114 9e-26
TF_66 Pti5 98 1e-21
TF_2_5 AP2/EREBPDREB2A 98 9e-21
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 93 1e-19
TF_65 Pti4 87 8e-18

TOP