AGI ID: At3g13040

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At3g13040
MYIKAIMNRH RLLSAATDEC NKKLGQACSS SLSPVHNFLN VQPEHRKTPF IRSQSPDSPG
QLWPKNSSQS TFSRSSTFCT NLYLSSSSTS ETQKHLGNSL PFLPDPSSYT HSASGVESAR
SPSIFTEDLG NQCDGGNSGS LLKDFLNLSG DACSDGDFHD FGCSNDSYCL SDQMELQFLS
DELELAITDR AETPRLDEIY ETPLASNPVT RLSPSQSCVP GAMSVDVVSS HPSPGSAANQ
KSRMRWTPEL HESFVKAVIK LEGPEKATPK AVKKLMNVEG LTIYHVKSHL QKYRLAKYMP
EKKEEKRTDN SEEKKLALSK SEADEKKKGA IQLTEALRMQ MEVQKQLHEQ LEVQRVLQLR
IEEHAKYLEK MLEEQRKTGR WISSSSQTVL SPSDDSIPDS QNMSKTKASS PQPPLPAENK
ASETEDDKCE SPQKRRRLEN IAESEDPKR
Length = 449 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g13040

>At3g13040 unknown protein
          Length = 449

 Score =  123 bits (309), Expect = 3e-28
 Identities = 43/69 (62%), Positives = 50/69 (72%)

Query: 178 PQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQ 237
           P   +    KSR+RWTPELH  FV AV  L GP+KATPK + KLM V+GLTIYH+KSHLQ
Sbjct: 232 PSPGSAANQKSRMRWTPELHESFVKAVIKLEGPEKATPKAVKKLMNVEGLTIYHVKSHLQ 291

Query: 238 KYRLNIRLP 246
           KYRL   +P
Sbjct: 292 KYRLAKYMP 300



 Score = 94.3 bits (233), Expect = 2e-19
 Identities = 26/48 (54%), Positives = 35/48 (72%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLTSR 432
           L EAL  QME+QK+LHEQLE QR LQL +E H +Y+  ++E++  T R
Sbjct: 333 LTEALRMQMEVQKQLHEQLEVQRVLQLRIEEHAKYLEKMLEEQRKTGR 380


InterPro Results:

IPR001005 Domain
PF00249 T[243-294] 1.3e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[241-297] 3.3e-29 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[237-301] 5.3e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[67-78] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like123 3e-28
TF_10_2 GARPARR-B class 97 2e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 75 2e-13
TF_1_2 MYB superfamilyLHY 68 1e-11

TOP