AGI ID: At3g12730

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: regulatory protein of P-starvation acclimation respons...

Amino Acid Sequence:


1
61
121
181
>At3g12730
MMQSREEIRD DSSSGLVLTT DPKPRLRWTT ELHERFVDAV THLGGPEKAT PKTIMRVMGV
KGLTLYHLKS HLQKFRLGKQ PHKEHSQNHS ICIRDTNRAS MLDLRRNAVF TTSPLIIGRN
MNEMQMEVQR RIEEEVVIER QVNQRIAAQG KYMESMLEKA CETQEASLTK DYSTLFFDRT
NICNNTSSIP IPWFEDHFPS SSSMDSTLIL PDINSNFSLQ DSRSSITKGR TVCLG
Length = 235 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g12730

>At3g12730 regulatory protein of P-starvation acclimation response Psr1,
           putative
          Length = 235

 Score =  112 bits (281), Expect = 5e-25
 Identities = 41/61 (67%), Positives = 49/61 (80%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           T   K RLRWT ELH RFV+AV  LGGP+KATPK I+++MGV GLT+YH+KSHLQK+RL 
Sbjct: 19  TTDPKPRLRWTTELHERFVDAVTHLGGPEKATPKTIMRVMGVKGLTLYHLKSHLQKFRLG 78

Query: 243 I 243
            
Sbjct: 79  K 79



 Score = 74.7 bits (182), Expect = 2e-13
 Identities = 16/48 (33%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 383 RNLEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLT 430
           RN+ E    QME+Q+++ E++  +RQ+   + A G+Y+ S++E+   T
Sbjct: 119 RNMNE---MQMEVQRRIEEEVVIERQVNQRIAAQGKYMESMLEKACET 163


InterPro Results:

IPR000508 Family
PS00501 ?[201-208] NA SPASE_I_1
Peptidase S26, signal peptidase I
IPR001005 Domain
PF00249 T[25-76] 8e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[23-79] 2e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[19-83] 1e-17 Homeodomain-like
Homeodomain-like
NULL
seg ?[123-145] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like112 5e-25
TF_10_2 GARPARR-B class 94 9e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 80 3e-15
TF_1_2 MYB superfamilyLHY 71 2e-12

TOP