AGI ID: At3g11580

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: putative DNA binding protein

Amino Acid Sequence:


1
61
121
181
241
>At3g11580
MSVNHYHNTL SLHHHHQNDV AIAQRESLFE KSLTPSDVGK LNRLVIPKQH AEKYFPLNNN
NNNGGSGDDV ATTEKGMLLS FEDESGKCWK FRYSYWNSSQ SYVLTKGWSR LFIGWRRRGE
ASSSPAVSVV SQEALVNTTA YWSGLTTPYR QVHASTTYPN IHQEYSHYGA VVDHAQSIPP
VVAGSSRTVR LFGVNLECHG DAVEPPPRPD VYNDQHIYYY STPHPMNISF AGEALEQVGD
GRG
Length = 243 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At3g11580

>At3g11580 putative DNA binding protein
          Length = 243

 Score =  130 bits (326), Expect = 4e-30
 Identities = 28/116 (24%), Positives = 38/116 (32%), Gaps = 32/116 (27%)

Query: 153 HPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPL----------DYSAQPPTQELVVRD 202
                F K+LT SD        +P++ AEK FP            D +       L   D
Sbjct: 24  QRESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNNNNNNGGSGDDVATTEKGMLLSFED 83

Query: 203 LHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRR 258
                W FR+ Y    + ++LT GWS                       L +G RR
Sbjct: 84  ESGKCWKFRYSYWNSSQSYVLTKGWSR----------------------LFIGWRR 117


InterPro Results:

NULL
seg ?[4-16]?[58-63]?[121-131] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5130 4e-30
TF_17_3 ARFETTIN/ARF3124 1e-28
TF_17_2 ARFNPH4/ARF7112 1e-24
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 90 6e-18
TF_22_1 ABI3/VP1FUSCA3 83 2e-16

TOP