AGI ID: At3g10760

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g10760
MREDDSDWFA RWEEELPSPE ELMPISQSLI SPDLALAFDI RTPNHGNGNS NQPHHHHHHQ
TTPPTPSQLQ LPSSQANSSA EFAADSADLG SGGAAGDEPA RTLKRPRLVW TPQLHKRFVD
AVAHLGIKNA VPKTIMQLMS VDGLTRENVA SHLQKYRLYL KRMQGLSSGG GAGSDPATDR
LFASSPVPAH FLHPNRVPSS DHFMPSFVPI ATLQQQQQMA AAAAAAAAAN PHLQPPQFHR
QIAAAHFGSP TNGGFSSPTS NGQFGSPTSN GFGSPTTNGK FDPSFLAVRQ TQQQPIQRMS
TPSLHSPVSN YVEDLESANA NGGRTVLTLF PTRDD
Length = 335 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At3g10760

>At3g10760 unknown protein
          Length = 335

 Score =  107 bits (268), Expect = 1e-24
 Identities = 38/60 (63%), Positives = 52/60 (86%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           +PR+VW+ +LH++FV AV  LG++ AVPK I++LM+V GLTRENVASHLQKYR+YL+R+ 
Sbjct: 105 RPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYLKRMQ 164


InterPro Results:

IPR001005 Domain
PF00249 T[107-157] 1.6e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[105-160] 1.2e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[101-164] 1.3e-20 Homeodomain-like
Homeodomain-like
NULL
seg ?[13-22]?[43-80]?[83-97]?[214-229] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class107 1e-24
TF_10_1 GARPG2-like109 7e-24
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 78 1e-14
TF_1_2 MYB superfamilyLHY 73 4e-13

TOP