AGI ID: At3g06220

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
>At3g06220
MASGDVLPRF YTVFLSCVSS NSLKLIPRSY YEHLPRRLPK TAILTGTGGR VWKVAMMSKR
EQVYLARGWE NFVADNELKD GEFLTFVFDG YKSYEVSIYG RGSCKETRAV VHVEEISDES
ESDNDSLGSL VDVTPMPAEE NSDDTEGDND SCDSVVDVTP MPVEEISDAS DSDYY
Length = 175 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g06220

>At3g06220 hypothetical protein
          Length = 175

 Score = 77.3 bits (189), Expect = 3e-14
 Identities = 22/95 (23%), Positives = 36/95 (37%), Gaps = 8/95 (8%)

Query: 574 VLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRM 633
            +  S V +    ++P+   E HLP    R     A+      RVW +           +
Sbjct: 12  TVFLSCVSSNSLKLIPRSYYE-HLP----RRLPKTAILTGTGGRVWKVAMMSKREQ---V 63

Query: 634 YLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKV 668
           YL     +FV  N L++G+F+    D      V +
Sbjct: 64  YLARGWENFVADNELKDGEFLTFVFDGYKSYEVSI 98


InterPro Results:

IPR003340 Family
PF02362 T[11-104] 1.8e-10 B3
Transcriptional factor B3
NULL
seg ?[114-126] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 77 3e-14

TOP