AGI ID: At3g06160

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At3g06160
MWATKSRRCA VHTSSMASGD VLPRFFTVFL SHCSSESMVI PRSYYNLLPR PLPKTAILIG
TGGRFWKVAM TSKQEQVYFE QGWGNFVADN QLKEGEFLTF VFDGHKSYEV SIYGRGDCKE
TRAVIQVEEI SDDTEDDNVS LHSPSNVSLD SLSNDSHHST SNVSLRSLSN DSLHGDAEIE
SDSEYSPENL PSASISVESV EVVNPTTSRQ RSYKRKTIEN PHLYLDDPNN VCFETCLKLR
KFELLVHAQL VKDYGLIFSD NVDYIDGYGK LTAKTTKWAD QRVCINKWQK ICERNQFTEN
DSILCEILRN EDKVVYAIKI HIFRDAAAST
Length = 330 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At3g06160

>At3g06160 hypothetical protein
          Length = 330

 Score = 72.3 bits (176), Expect = 9e-13
 Identities = 22/121 (18%), Positives = 40/121 (32%), Gaps = 17/121 (14%)

Query: 574 VLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRM 633
            +  S   +    V+P+      LP    R     A+      R W +      + + ++
Sbjct: 27  TVFLSHCSSESM-VIPRSYY-NLLP----RPLPKTAILIGTGGRFWKVAM---TSKQEQV 77

Query: 634 YLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKV--------RQPSGQKPEAPPSSAAT 685
           Y  +  G+FV  N L+EG+F+    D      V +         +   Q  E    +   
Sbjct: 78  YFEQGWGNFVADNQLKEGEFLTFVFDGHKSYEVSIYGRGDCKETRAVIQVEEISDDTEDD 137

Query: 686 K 686
            
Sbjct: 138 N 138


InterPro Results:

IPR003340 Family
PF02362 T[24-118] 9.3e-08 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[56-125] 0.02 Cupredoxins
Cupredoxin
NULL
seg ?[142-162]?[192-203] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 72 9e-13

TOP