AGI ID: At3g04450

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: transfactor like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At3g04450
MNNNPVPCQV FPLVSGGSSG GNLFSSSSGF CNGVYVSSSS QARPSVSTVP RDRITVAHVS
GEGQRQECPV ETHSLQLINQ PQEQKIMTWS SDQIRGFFDF PVPDPQAASS RTMVSSKEVL
SKCEWPDWAD QLISDDSLEP NWSELLGDPN VLNLYSKIET QSSDIARQEI VFRNQHQVDP
SMEPFNAKSP PASSMTSKQR MRWTPELHEA FVEAINQLGG SERATPKAVL KLINSPGLTV
YHVKSHLQKY RTARYKPELS KDTEEPLVKN LKTIEDIKSL DLKTSIEITE ALRLQMKVQK
QLHEQLEIQR SLQLQIEEQG RYLQMMIEKQ QKMQENKKDS TSSSSMPEAD PSAPSPNLSQ
PFLHKATNSE PSITQKLQNG SSTMDQSEST SGTSNRKRVR ED
Length = 402 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g04450

>At3g04450 transfactor like protein
          Length = 402

 Score =  123 bits (310), Expect = 3e-28
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 5/76 (6%)

Query: 176 MQPQRAATGPA-----KSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIY 230
           M+P  A + PA     K R+RWTPELH  FV A+N LGG ++ATPK +LKL+   GLT+Y
Sbjct: 182 MEPFNAKSPPASSMTSKQRMRWTPELHEAFVEAINQLGGSERATPKAVLKLINSPGLTVY 241

Query: 231 HIKSHLQKYRLNIRLP 246
           H+KSHLQKYR     P
Sbjct: 242 HVKSHLQKYRTARYKP 257



 Score = 92.8 bits (229), Expect = 7e-19
 Identities = 23/45 (51%), Positives = 33/45 (73%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGL 429
           + EAL  QM++QK+LHEQLE QR LQL +E  GRY+  ++E++  
Sbjct: 288 ITEALRLQMKVQKQLHEQLEIQRSLQLQIEEQGRYLQMMIEKQQK 332


InterPro Results:

IPR001005 Domain
PF00249 T[200-251] 3.5e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[198-254] 3.1e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[194-258] 1.7e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[15-33]?[34-49]?[324-338] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like123 3e-28
TF_10_2 GARPARR-B class 99 5e-22
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 85 8e-17
TF_1_2 MYB superfamilyLHY 73 4e-13

TOP