AGI ID: At3g04030

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: transfactor like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At3g04030
MYYQNQHQGK NILSSSRMHI TSERHPFLRG NSPGDSGLIL STDAKPRLKW TPDLHERFIE
AVNQLGGADK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANNS FNKIGIMTMM
EEKTPDADEI QSENLSIGPQ PNKNSPIGEA LQMQIEVQRR LHEQLELRIE AQGKYLQSVL
EKAQETLGRQ NLGAAGIEAA KVQLSELVSK VSAEYPNSSF LEPKELQNLC SQQMQTNYPP
DCSLESCLTS SEGTQKNSKM LENNRLGLRT YIGDSTSEQK EIMEEPLFQR MELTWTEGLR
GNPYLSTMVS EAEQRISYSE RSPGRLSIGV GLHGHKSQHQ QGNNEDHKLE TRNRKGMDST
TELDLNTHVE NYCTTRTKQF DLNGFSWN
Length = 388 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At3g04030

>At3g04030 transfactor like protein
          Length = 388

 Score =  114 bits (286), Expect = 2e-25
 Identities = 41/61 (67%), Positives = 51/61 (83%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           +  AK RL+WTP+LH RF+ AVN LGG DKATPK I+K+MG+ GLT+YH+KSHLQKYRL+
Sbjct: 41  STDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLS 100

Query: 243 I 243
            
Sbjct: 101 K 101



 Score = 77.0 bits (188), Expect = 3e-14
 Identities = 20/46 (43%), Positives = 31/46 (66%), Gaps = 6/46 (13%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLT 430
           + EAL  Q+E+Q++LHEQLE      L +EA G+Y+ S++E+   T
Sbjct: 147 IGEALQMQIEVQRRLHEQLE------LRIEAQGKYLQSVLEKAQET 186


InterPro Results:

IPR000905 Domain
PS01016 ?[74-94] NA GLYCOPROTEASE
Peptidase M22, glycoprotease
IPR001005 Domain
PF00249 T[47-98] 6.4e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[45-101] 3.6e-29 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[41-105] 5.6e-19 Homeodomain-like
Homeodomain-like

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like114 2e-25
TF_10_2 GARPARR-B class 97 1e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 81 2e-15
TF_1_2 MYB superfamilyLHY 72 8e-13

TOP