AGI ID: At2g47520

TF ID:TF_67
Super family:Pti6
Sub family:
Gene name: putative AP2 domain transcription factor

Amino Acid Sequence:


1
61
121
>At2g47520
MCGGAIISDF IWSKSESEPS QLGSVSSRKK RKPVSVSEER DGKRERKNLY RGIRQRPWGK
WAAEIRDPSK GVRVWLGTFK TADEAARAYD VAAIKIRGRK AKLNFPNTQV EEEADTKPGG
NQNELISENQ VESLSEDLMA LEDYMRFYQI PVADDQSATD IGNLWSYQDS N
Length = 171 AA.

PSI BLAST Result:

Query: Query sequence of TF_67
Sbjct: At2g47520

>At2g47520 putative AP2 domain transcription factor
          Length = 171

 Score =  137 bits (346), Expect = 4e-33
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 2/94 (2%)

Query: 63  KRHVTEINLMPSTKSIGDRKRRSVSPDSDVTRRKK--FRGVRQRPWGRWAAEIRDPTRGK 120
            +  +E + + S  S   RK  SVS + D  R +K  +RG+RQRPWG+WAAEIRDP++G 
Sbjct: 13  SKSESEPSQLGSVSSRKKRKPVSVSEERDGKRERKNLYRGIRQRPWGKWAAEIRDPSKGV 72

Query: 121 RVWLGTYDTPEEAAVVYDKAAVKLKGPDAVTNFP 154
           RVWLGT+ T +EAA  YD AA+K++G  A  NFP
Sbjct: 73  RVWLGTFKTADEAARAYDVAAIKIRGRKAKLNFP 106


InterPro Results:

IPR001471 Domain
PD001423 T[56-96] 1e-10 sp_O22259_ARATH_O22259;
PR00367 T[50-61] 9.3e-13T[72-88] 9.3e-13 ETHRSPELEMNT
PF00847 T[48-111] 3.5e-41 AP2
SM00380 T[49-112] 2e-42 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[24-37]?[82-93] seg
SSF54171 T[48-108] 1.2e-24 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_67 Pti6137 4e-33
TF_2_2 AP2/EREBPAINTEGUMENTA132 4e-31
TF_68 ERF126 9e-30
TF_2_4 AP2/EREBPCBF1124 3e-29
TF_2_3 AP2/EREBPAPETALA2125 6e-29
TF_66 Pti5120 4e-28
TF_2_5 AP2/EREBPDREB2A109 3e-24
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4102 3e-22
TF_65 Pti4 89 2e-18

TOP